DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and Chchd2

DIOPT Version :9

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_077128.2 Gene:Chchd2 / 14004 MGIID:1261428 Length:153 Species:Mus musculus


Alignment Length:171 Identity:81/171 - (47%)
Similarity:99/171 - (57%) Gaps:21/171 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRRGRSASPPPSTRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMP--APQQ 63
            |.|..||     .|.|..|..:|||....||  .||||      ...|.:|.|||||.|  ||:|
Mouse     1 MPRGSRS-----RTSRVTPPASRAPQMRAAP--RRAPA------AQPPAAAAPSAVGSPAAAPRQ 52

  Fly    64 PSMFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKEAAAPAPAAAAPAPQQPYYAQQQQPNE 128
            |.:..|||.||.|||||||:|||:||.:|..|||.|..|.|.|....     |:|..||.|. .:
Mouse    53 PGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGGSAEPAKPDITY-----QEPQGAQLQN-QQ 111

  Fly   129 PQGACAWELKQFIQCAQGQADLTLCEGFNEALRQCKQSHHL 169
            ..|.|:.|:|||::|||.|:|:.|||||||.||||:.::.|
Mouse   112 SFGPCSLEIKQFLECAQNQSDVKLCEGFNEVLRQCRIANGL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 21/31 (68%)
Chchd2NP_077128.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 17/49 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..106 17/27 (63%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 116..126 5/9 (56%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 136..146 6/9 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836193
Domainoid 1 1.000 131 1.000 Domainoid score I5136
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49449
Inparanoid 1 1.050 131 1.000 Inparanoid score I4610
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001898
OrthoInspector 1 1.000 - - otm43080
orthoMCL 1 0.900 - - OOG6_103181
Panther 1 1.100 - - O PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 1 1.000 - - X1616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.