DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and Chchd10

DIOPT Version :9

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_780538.2 Gene:Chchd10 / 103172 MGIID:2143558 Length:138 Species:Mus musculus


Alignment Length:173 Identity:78/173 - (45%)
Similarity:96/173 - (55%) Gaps:43/173 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRRGRSASPPPSTRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMPAPQQPS 65
            |.|..|||:..|.:|         |||.||     .|.|:|:||.||            ||.||.
Mouse     1 MPRGSRSAAARPVSR---------PAPPPA-----HPPPSAAAPAPA------------APGQPG 39

  Fly    66 MFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKEAAAP----APAAAAPAPQQPYYAQQQQP 126
            :..|||:||.|||||||:||.:|..|||.||| |:.|.|.|    |||..|..|.|         
Mouse    40 LMAQMASTAAGVAVGSAVGHVMGSALTSAFSG-GNSEPAQPAVQQAPARPASHPLQ--------- 94

  Fly   127 NEPQGACAWELKQFIQCAQGQADLTLCEGFNEALRQCKQSHHL 169
               .|.|::|:|||:.|:..|:||||||||:|||:|||.:|.|
Mouse    95 ---MGPCSYEIKQFLDCSTTQSDLTLCEGFSEALKQCKYNHGL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 20/31 (65%)
Chchd10NP_780538.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I5136
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4610
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 1 1.010 - - D1611117at2759
OrthoFinder 1 1.000 - - FOG0001898
OrthoInspector 1 1.000 - - otm43080
orthoMCL 1 0.900 - - OOG6_103181
Panther 1 1.100 - - LDO PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 1 1.000 - - X1616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.870

Return to query results.
Submit another query.