DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and chchd10

DIOPT Version :9

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_002940705.2 Gene:chchd10 / 100379881 XenbaseID:XB-GENE-5962008 Length:147 Species:Xenopus tropicalis


Alignment Length:171 Identity:77/171 - (45%)
Similarity:95/171 - (55%) Gaps:34/171 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRRGRSASPPPSTRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMPAPQQPS 65
            |.|.||||.|     |||...|.:|||||||..   |.|:|.|..|||            .|.|.
 Frog     1 MARGGRSAPP-----RTASSHASSPAPAPAPAN---PPPSALASAPAP------------SQGPG 45

  Fly    66 MFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKEA--AAPAPAAAAPAPQQ--PYYAQQQQP 126
            :..|||.||.|||||||:||.:|..||..||||..:.|  .|..|..::..|||  |::      
 Frog    46 LMAQMATTAAGVAVGSAVGHVLGGALTGAFSGSSSEPAKPVAQEPQRSSAVPQQIPPHH------ 104

  Fly   127 NEPQGACAWELKQFIQCAQGQADLTLCEGFNEALRQCKQSH 167
                |.|.:|:|||:.||..|:||||||||:|.|:|||.::
 Frog   105 ----GPCHYEMKQFLDCATTQSDLTLCEGFSEVLKQCKSNN 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 20/31 (65%)
chchd10XP_002940705.2 DUF2076 <35..>90 CDD:421358 29/66 (44%)
CHCH 107..140 CDD:399611 21/32 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1611117at2759
OrthoFinder 1 1.000 - - FOG0001898
OrthoInspector 1 1.000 - - otm48209
Panther 1 1.100 - - LDO PTHR13523
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 1 1.000 - - X1616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.140

Return to query results.
Submit another query.