DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5a and RPS5B

DIOPT Version :9

Sequence 1:NP_001285360.1 Gene:RpS5a / 32700 FlyBaseID:FBgn0002590 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001031502.1 Gene:RPS5B / 818304 AraportID:AT2G37270 Length:207 Species:Arabidopsis thaliana


Alignment Length:214 Identity:156/214 - (72%)
Similarity:181/214 - (84%) Gaps:11/214 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AAPMEAEVAETILETNVVSTTELPEIKLFGRWSCDDVTVNDISLQDYISVK-EKFARYLPHSAGR 79
            :|.::||:.:.:  ||        |:|||.|||.|||:|.||||.|||.|: .|.|.::||:|||
plant     4 SAEIDAEIQQQL--TN--------EVKLFNRWSFDDVSVTDISLVDYIGVQPSKHATFVPHTAGR 58

  Fly    80 YAAKRFRKAQCPIVERLTCSLMMKGRNNGKKLMACRIVKHSFEIIHLLTGENPLQILVSAIINSG 144
            |:.|||||||||||||||.||||.||||||||||.|||||:.||||||:..||:|:::.||:|||
plant    59 YSVKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLSDLNPIQVIIDAIVNSG 123

  Fly   145 PREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSS 209
            ||||:||||.||.|||||||:||||||||||:||.||||||||||||||||||||||||||||||
plant   124 PREDATRIGSAGVVRRQAVDISPLRRVNQAIFLLTTGAREAAFRNIKTIAECLADELINAAKGSS 188

  Fly   210 NSYAIKKKDELERVAKSNR 228
            ||||||||||:|||||:||
plant   189 NSYAIKKKDEIERVAKANR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5aNP_001285360.1 uS7_Eukaryote 42..228 CDD:271246 148/186 (80%)
RPS5BNP_001031502.1 uS7_Eukaryote 20..207 CDD:271246 148/186 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 241 1.000 Domainoid score I583
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H783
Inparanoid 1 1.050 301 1.000 Inparanoid score I783
OMA 1 1.010 - - QHG62189
OrthoDB 1 1.010 - - D1532160at2759
OrthoFinder 1 1.000 - - FOG0003144
OrthoInspector 1 1.000 - - mtm1196
orthoMCL 1 0.900 - - OOG6_100920
Panther 1 1.100 - - O PTHR11205
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2112
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.