DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5a and zgc:153322

DIOPT Version :9

Sequence 1:NP_001285360.1 Gene:RpS5a / 32700 FlyBaseID:FBgn0002590 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001038898.2 Gene:zgc:153322 / 751723 ZFINID:ZDB-GENE-060825-73 Length:212 Species:Danio rerio


Alignment Length:212 Identity:176/212 - (83%)
Similarity:194/212 - (91%) Gaps:2/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MEAEVAET--ILETNVVSTTELPEIKLFGRWSCDDVTVNDISLQDYISVKEKFARYLPHSAGRYA 81
            |:.|..||  ::.....:..||||:||||||||:||.|:|:||||||:|||.:|:::||||||||
Zfish     1 MDDENWETDAVMVATAPAPAELPEVKLFGRWSCEDVQVSDMSLQDYIAVKENYAKFIPHSAGRYA 65

  Fly    82 AKRFRKAQCPIVERLTCSLMMKGRNNGKKLMACRIVKHSFEIIHLLTGENPLQILVSAIINSGPR 146
            ||||||||||||||:|.||||.||||||||||.||:||:.|||||||||||||:||:||||||||
Zfish    66 AKRFRKAQCPIVERVTNSLMMHGRNNGKKLMAVRIMKHAMEIIHLLTGENPLQVLVNAIINSGPR 130

  Fly   147 EDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNS 211
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish   131 EDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNS 195

  Fly   212 YAIKKKDELERVAKSNR 228
            |||||||||||||||||
Zfish   196 YAIKKKDELERVAKSNR 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5aNP_001285360.1 uS7_Eukaryote 42..228 CDD:271246 166/185 (90%)
zgc:153322NP_001038898.2 uS7_Eukaryote 26..212 CDD:271246 166/185 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.