DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5a and rps5

DIOPT Version :9

Sequence 1:NP_001285360.1 Gene:RpS5a / 32700 FlyBaseID:FBgn0002590 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001016992.1 Gene:rps5 / 549746 XenbaseID:XB-GENE-919703 Length:203 Species:Xenopus tropicalis


Alignment Length:192 Identity:173/192 - (90%)
Similarity:183/192 - (95%) Gaps:0/192 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ELPEIKLFGRWSCDDVTVNDISLQDYISVKEKFARYLPHSAGRYAAKRFRKAQCPIVERLTCSLM 101
            |.|||||||:||.|||.:|||||||||:||||:|::||||.||||||||||||||||||.|.|||
 Frog    12 ETPEIKLFGKWSTDDVQINDISLQDYIAVKEKYAKFLPHSGGRYAAKRFRKAQCPIVERFTNSLM 76

  Fly   102 MKGRNNGKKLMACRIVKHSFEIIHLLTGENPLQILVSAIINSGPREDSTRIGRAGTVRRQAVDVS 166
            |.|||||||||..|||||:||||||||||||||:||:||||||||||||||||||||||||||||
 Frog    77 MHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVRRQAVDVS 141

  Fly   167 PLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKKKDELERVAKSNR 228
            ||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||
 Frog   142 PLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELINAAKGSSNSYAIKKKDELERVAKSNR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5aNP_001285360.1 uS7_Eukaryote 42..228 CDD:271246 167/185 (90%)
rps5NP_001016992.1 uS7_Eukaryote 17..203 CDD:271246 167/185 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 265 1.000 Domainoid score I1873
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H783
Inparanoid 1 1.050 349 1.000 Inparanoid score I2233
OMA 1 1.010 - - QHG62189
OrthoDB 1 1.010 - - D1532160at2759
OrthoFinder 1 1.000 - - FOG0003144
OrthoInspector 1 1.000 - - otm48513
Panther 1 1.100 - - O PTHR11205
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2112
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.