DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5a and MRPS7

DIOPT Version :9

Sequence 1:NP_001285360.1 Gene:RpS5a / 32700 FlyBaseID:FBgn0002590 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_057055.2 Gene:MRPS7 / 51081 HGNCID:14499 Length:242 Species:Homo sapiens


Alignment Length:210 Identity:50/210 - (23%)
Similarity:89/210 - (42%) Gaps:35/210 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RWSCDDVTVND--ISLQDY------ISVKEKFARYLPHS---AGRYAAKRFRKAQCPIVERLTCS 99
            |||.......|  |..:.|      ::.:||:.|.|..:   ....|.|.....:.|::.:.| :
Human    33 RWSRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFT-N 96

  Fly   100 LMMKGRNNGKKLMACRIV--------KHSFEIIHLLTGE-------NPLQILVSAIINSGPREDS 149
            :||.|   |.|::|..::        :..||..|..:.|       ||..|...|:.|..|....
Human    97 MMMIG---GNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGL 158

  Fly   150 TRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTI-AECLADELINAAKGSSNSYA 213
            ..|.:.|...:..|.:...||...|:..:.|..|:.  ::.:|: .|.|:.:|:.|.  .:....
Human   159 VPILKGGRFYQVPVPLPDRRRRFLAMKWMITECRDK--KHQRTLMPEKLSHKLLEAF--HNQGPV 219

  Fly   214 IKKKDELERVAKSNR 228
            ||:|.:|.::|::||
Human   220 IKRKHDLHKMAEANR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5aNP_001285360.1 uS7_Eukaryote 42..228 CDD:271246 48/208 (23%)
MRPS7NP_057055.2 uS7_Mitochondria_Mammalian 35..240 CDD:271249 48/208 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.