DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5a and RpS5b

DIOPT Version :9

Sequence 1:NP_001285360.1 Gene:RpS5a / 32700 FlyBaseID:FBgn0002590 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster


Alignment Length:230 Identity:184/230 - (80%)
Similarity:206/230 - (89%) Gaps:5/230 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VAENVVETFEEPAA---PMEAE-VAETILET-NVVSTTELPEIKLFGRWSCDDVTVNDISLQDYI 63
            ::|.|||:..:.|:   |.|.| .|:.::.| .....||.|||||||||:|||::::||||||||
  Fly     1 MSEEVVESSSQEASQVIPQEQEDWADDVVTTMPAQEVTEWPEIKLFGRWACDDISISDISLQDYI 65

  Fly    64 SVKEKFARYLPHSAGRYAAKRFRKAQCPIVERLTCSLMMKGRNNGKKLMACRIVKHSFEIIHLLT 128
            :|||||||||||||||||||||||||||||||||..||||||:|||||:|||||||:||||||||
  Fly    66 AVKEKFARYLPHSAGRYAAKRFRKAQCPIVERLTSGLMMKGRSNGKKLLACRIVKHAFEIIHLLT 130

  Fly   129 GENPLQILVSAIINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTI 193
            .|||||:.|:||:||||||||||||||||||||||||||||||||||||:||||||||||||||:
  Fly   131 SENPLQVTVNAIVNSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLICTGAREAAFRNIKTV 195

  Fly   194 AECLADELINAAKGSSNSYAIKKKDELERVAKSNR 228
            |||||||||||||||||||||||||||||||||||
  Fly   196 AECLADELINAAKGSSNSYAIKKKDELERVAKSNR 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5aNP_001285360.1 uS7_Eukaryote 42..228 CDD:271246 167/185 (90%)
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 167/185 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454808
Domainoid 1 1.000 241 1.000 Domainoid score I583
eggNOG 1 0.900 - - E1_COG0049
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 301 1.000 Inparanoid score I783
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62189
OrthoDB 1 1.010 - - D107047at50557
OrthoFinder 1 1.000 - - FOG0003144
OrthoInspector 1 1.000 - - otm26493
orthoMCL 1 0.900 - - OOG6_100920
Panther 1 1.100 - - P PTHR11205
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2112
1211.810

Return to query results.
Submit another query.