DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5a and mRpS7

DIOPT Version :9

Sequence 1:NP_001285360.1 Gene:RpS5a / 32700 FlyBaseID:FBgn0002590 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001260339.1 Gene:mRpS7 / 34412 FlyBaseID:FBgn0032236 Length:218 Species:Drosophila melanogaster


Alignment Length:190 Identity:53/190 - (27%)
Similarity:81/190 - (42%) Gaps:37/190 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NDISLQDYISVKEK--------FARYLPHSAGRYAAKRFRKAQCPIVERLTCSLMMKGRNNGKKL 111
            ||:|...::.:|..        |.....|....|..|:...|       |..:|:.|        
  Fly    42 NDLSKLYHVPIKAAVNKSSDTIFHDDTKHKMINYITKKGNSA-------LARTLLSK-------- 91

  Fly   112 MACRIVKHS-FEIIHLLTGE------NPLQILVSAIINSGPREDSTRIGRAGTVRRQAVDVSPLR 169
             ...::|.: .|.::|..||      ||..:|..|:.|..|....|.|.|.|...:..|.::..|
  Fly    92 -TLELIKRTQTEHMNLAKGEKTTINTNPETLLKQAVENCRPLLQVTAIKRGGVTYQVPVPITTKR 155

  Fly   170 RVNQAI-WLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKKKDELERVAKSNR 228
            ....|: ||| ..|||.. |.: ::.|.||.|:::||.|...  .||:||:|.|:.:|||
  Fly   156 SYFLAMKWLL-EAAREKE-RKV-SLPEKLAWEILDAAHGQGR--VIKRKDDLHRLCESNR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5aNP_001285360.1 uS7_Eukaryote 42..228 CDD:271246 51/188 (27%)
mRpS7NP_001260339.1 uS7_Mitochondria_Mammalian 21..216 CDD:271249 53/190 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443091
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0049
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11205
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.