DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5a and Rps5

DIOPT Version :9

Sequence 1:NP_001285360.1 Gene:RpS5a / 32700 FlyBaseID:FBgn0002590 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001264172.1 Gene:Rps5 / 25538 RGDID:3601 Length:204 Species:Rattus norvegicus


Alignment Length:200 Identity:177/200 - (88%)
Similarity:188/200 - (94%) Gaps:0/200 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ETNVVSTTELPEIKLFGRWSCDDVTVNDISLQDYISVKEKFARYLPHSAGRYAAKRFRKAQCPIV 93
            ||...:..|.|:|||||:||.|||.:|||||||||:||||:|:||||||||||||||||||||||
  Rat     5 ETATPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQCPIV 69

  Fly    94 ERLTCSLMMKGRNNGKKLMACRIVKHSFEIIHLLTGENPLQILVSAIINSGPREDSTRIGRAGTV 158
            ||||.|:||.|||||||||..|||||:||||||||||||||:||:||||||||||||||||||||
  Rat    70 ERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTV 134

  Fly   159 RRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKKKDELERV 223
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   135 RRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKKKDELERV 199

  Fly   224 AKSNR 228
            |||||
  Rat   200 AKSNR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5aNP_001285360.1 uS7_Eukaryote 42..228 CDD:271246 170/185 (92%)
Rps5NP_001264172.1 uS7_Eukaryote 18..204 CDD:271246 170/185 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344417
Domainoid 1 1.000 263 1.000 Domainoid score I1861
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H783
Inparanoid 1 1.050 349 1.000 Inparanoid score I2215
OMA 1 1.010 - - QHG62189
OrthoDB 1 1.010 - - D1532160at2759
OrthoFinder 1 1.000 - - FOG0003144
OrthoInspector 1 1.000 - - otm45434
orthoMCL 1 0.900 - - OOG6_100920
Panther 1 1.100 - - O PTHR11205
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2112
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.