DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5a and rps5

DIOPT Version :9

Sequence 1:NP_001285360.1 Gene:RpS5a / 32700 FlyBaseID:FBgn0002590 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_775339.1 Gene:rps5 / 192297 ZFINID:ZDB-GENE-020419-12 Length:204 Species:Danio rerio


Alignment Length:207 Identity:176/207 - (85%)
Similarity:188/207 - (90%) Gaps:8/207 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EVAETILETNVVSTTELPEIKLFGRWSCDDVTVNDISLQDYISVKEKFARYLPHSAGRYAAKRFR 86
            |.|..:.||        |||||||:||.|||.:|||||||||:||||:|:|||||:|||||||||
Zfish     6 EAAPAVAET--------PEIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSSGRYAAKRFR 62

  Fly    87 KAQCPIVERLTCSLMMKGRNNGKKLMACRIVKHSFEIIHLLTGENPLQILVSAIINSGPREDSTR 151
            |||||||||:|.|:||.||||||||:..|||||:|||||||||||||||||:|||||||||||||
Zfish    63 KAQCPIVERVTNSMMMHGRNNGKKLLTVRIVKHAFEIIHLLTGENPLQILVNAIINSGPREDSTR 127

  Fly   152 IGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKK 216
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||.|||||||
Zfish   128 IGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSYNSYAIKK 192

  Fly   217 KDELERVAKSNR 228
            ||||||||||||
Zfish   193 KDELERVAKSNR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5aNP_001285360.1 uS7_Eukaryote 42..228 CDD:271246 167/185 (90%)
rps5NP_775339.1 uS7_Eukaryote 18..204 CDD:271246 167/185 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585495
Domainoid 1 1.000 265 1.000 Domainoid score I1865
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H783
Inparanoid 1 1.050 351 1.000 Inparanoid score I2242
OMA 1 1.010 - - QHG62189
OrthoDB 1 1.010 - - D1532160at2759
OrthoFinder 1 1.000 - - FOG0003144
OrthoInspector 1 1.000 - - otm26493
orthoMCL 1 0.900 - - OOG6_100920
Panther 1 1.100 - - O PTHR11205
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2272
SonicParanoid 1 1.000 - - X2112
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.