DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5004 and LOC799656

DIOPT Version :9

Sequence 1:NP_573195.1 Gene:CG5004 / 32698 FlyBaseID:FBgn0260748 Length:1247 Species:Drosophila melanogaster
Sequence 2:XP_001339991.6 Gene:LOC799656 / 799656 -ID:- Length:202 Species:Danio rerio


Alignment Length:133 Identity:55/133 - (41%)
Similarity:75/133 - (56%) Gaps:1/133 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1116 DLNLRHHIETAGHQIDPCPHVFVDAHSCRGYLHKLGATFHAWSRRWFVLDRQRSALIYYSDKSER 1180
            |.:||.|:|:.||.:..|..|.:.:..|.|:|.|.|.....|.||||:.|.....|.||::..|:
Zfish    70 DFDLRAHVESLGHNVSGCMGVNLSSRRCGGFLTKRGGRVKTWRRRWFIFDLDHQRLAYYTELDEK 134

  Fly  1181 KPRGGAYFATIDEVYLDHL-NASKSGRPHCTFIVKTKKRSYNLQAASDSAARIWIDAIITGAQGN 1244
            |.:|..||..|:|||.||| .|:.|.||..||.|||.:|.:.|.:.|..|.|||:|.|:|....:
Zfish   135 KLKGVIYFQAIEEVYYDHLRTAATSPRPSLTFCVKTYERLFFLVSHSAEAMRIWMDVIVTATDEH 199

  Fly  1245 LDY 1247
            ..|
Zfish   200 SRY 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5004NP_573195.1 FHA 41..104 CDD:278899
PH-like 1142..1242 CDD:302622 45/100 (45%)
PH 1143..1237 CDD:278594 43/94 (46%)
LOC799656XP_001339991.6 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D45023at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.