DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5004 and sub

DIOPT Version :9

Sequence 1:NP_573195.1 Gene:CG5004 / 32698 FlyBaseID:FBgn0260748 Length:1247 Species:Drosophila melanogaster
Sequence 2:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster


Alignment Length:299 Identity:58/299 - (19%)
Similarity:103/299 - (34%) Gaps:111/299 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTKKDPSLRVAASDPHLVSLGGGRLSTAVT-----------------IHYIHIGDTTIGSAASCS 50
            :|..:.:||       |:.||..|.:.|.|                 :.|...|.||..|...|.
  Fly   323 VTSSEEALR-------LLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQSSYKFCD 380

  Fly    51 IS----LNGSGVRPL----------------HC-----TIYRSDANEVTLVPEKDSRL-LIDGAP 89
            ::    :|.:|...|                .|     |:.:.  ....::|.:||:| ::..|.
  Fly   381 LAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKK--KNADIIPYRDSKLTMLLQAA 443

  Fly    90 ILEETKLSQGAMITI--------GNSNYLRFNNPDEAQMMRSAMGSNERISMPQI---------- 136
            :|.:.||:.  ::|:        .|.|.|.|.:..:..:.:..:....|:|....          
  Fly   444 LLGKEKLAM--IVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCGFMEFSKMSTCE 506

  Fly   137 --DFT--------------QSARQAHELSQSL-------ELESFYESIINPINNPSTYELECPKV 178
              |:|              :..:..|.|...|       ||.:.|:.||.  ||...||.||.| 
  Fly   507 GGDYTKELEDENVRLQLEIEQLKYDHVLQMQLLEEKLRRELTATYQEIIQ--NNKKQYEDECEK- 568

  Fly   179 FSSDLVTVNMPAKDVLGQKYASFARNLAENHRNEKQLNN 217
                        |.::.|:.:.|..: ::..|.|:|:.:
  Fly   569 ------------KLLIAQRESEFMLS-SQRRRYEEQIED 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5004NP_573195.1 FHA 41..104 CDD:278899 17/88 (19%)
PH-like 1142..1242 CDD:302622
PH 1143..1237 CDD:278594
subNP_001286548.1 KISc 89..477 CDD:276812 33/164 (20%)
Kinesin 93..479 CDD:278646 33/166 (20%)
GBP_C <512..603 CDD:303769 21/99 (21%)
coiled coil 576..586 CDD:293879 1/10 (10%)
coiled coil 592..603 CDD:293879 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.