DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5004 and neb

DIOPT Version :9

Sequence 1:NP_573195.1 Gene:CG5004 / 32698 FlyBaseID:FBgn0260748 Length:1247 Species:Drosophila melanogaster
Sequence 2:NP_476817.1 Gene:neb / 35293 FlyBaseID:FBgn0004374 Length:1121 Species:Drosophila melanogaster


Alignment Length:417 Identity:83/417 - (19%)
Similarity:142/417 - (34%) Gaps:134/417 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LVSLGGGRLSTAVTIHYIHIGDTTIGSAASCSISLNGSGVRPLHCTIYRSDANEVTLVP-EKDSR 82
            ||.:|.|||...             .|::...|.|:|..|...||:|......::.::| .:|..
  Fly   657 LVRIGRGRLPGG-------------SSSSQPDIVLDGPLVALQHCSIEHERGGKLYVIPGSEDFE 708

  Fly    83 LLIDGAPILEETKLSQGAMITIGNSNYLRFNNP-----------------------DEAQMMRSA 124
            ..::|..:.:..:|..|..:.||.|:|.|.:||                       .:.|.:||.
  Fly   709 TYVNGELLKDRRQLFHGDRLVIGGSHYFRISNPFCSQRGKADHPVDFQLAHQEILQKQEQQLRSE 773

  Fly   125 MGSNERISMPQI--DFTQSARQAHELSQSLELESFYESIINPINNPSTYELECPKVFSSDLVTVN 187
            :.:.:|.::.:|  :..|.||...|..|.||||.|              :.:|    :|:::...
  Fly   774 LEAEKRAALTKIEQERAQHARDFEERLQCLELEQF--------------KYKC----NSEMLETE 820

  Fly   188 MPAKDVLGQKYASFARNLAENH---RNEKQLNNQYAKG--------VGSNGGYWNVPSNAAIYKE 241
            ..|..:..|          :.|   |:|..::....|.        :..|....::.....:.||
  Fly   821 RQALALAQQ----------QEHTPLRHEDAVSTPAQKSTILEDIQRIMLNPSEESLHKTQLMVKE 875

  Fly   242 QHQQQHQ----------QAPQD---------LLTKVNNDRYDRYPKAGGLQIYSMNGVNSDINNG 287
            ..|:..|          |.|.:         :|.|....:.: :|.|       ..||..|:   
  Fly   876 ATQRCRQLDLPLEFRQTQTPDEFGLLRTVILILDKQRGLKAE-WPTA-------RLGVWLDL--- 929

  Fly   288 PATGNNSGTGGGAELEDMLKICTEY-----------ADRNNSMPSTHNVSSTSSITSSPIVQNRI 341
                    ....||.::.|...|.:           ||.|.::..|||   :|.|..:......:
  Fly   930 --------VRDNAEQQEKLNATTIFQSVEVDWEPLDADLNETLSDTHN---SSRIALNLSAMKDV 983

  Fly   342 KTNGSLPR----DKNKSPFPQQAGVAS 364
            ..|..|.|    ..:||..|:|....|
  Fly   984 LLNKPLKRLLNASSSKSNTPRQTSTPS 1010

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5004NP_573195.1 FHA 41..104 CDD:278899 13/63 (21%)
PH-like 1142..1242 CDD:302622
PH 1143..1237 CDD:278594
nebNP_476817.1 KISc_KIF1A_KIF1B 119..525 CDD:276816
KISc 120..525 CDD:214526
Kinesin_assoc 524..657 CDD:292801 83/417 (20%)
FHA 634..740 CDD:238017 24/95 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437953
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.