DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc3B and ARC18

DIOPT Version :9

Sequence 1:NP_573193.1 Gene:Arpc3B / 32696 FlyBaseID:FBgn0065032 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_013474.3 Gene:ARC18 / 851085 SGDID:S000004362 Length:178 Species:Saccharomyces cerevisiae


Alignment Length:178 Identity:78/178 - (43%)
Similarity:108/178 - (60%) Gaps:9/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAFHSEI---EDFQASVGNMALLPLRTQVRGPAPTVDIPNDIIDESLYFWKSNIFFRTYEVKSE 62
            |||:||..   .:....|||.|||||.|:.||||...:...|||||.|..:::|.||:.:|:||.
Yeast     1 MPAYHSTFPVDPNTDRMVGNFALLPLNTKFRGPAYPSNSDYDIIDECLDLFRANSFFKNFEIKSP 65

  Fly    63 VDRVLIYITLYITECLKRLARCTSKSQGQQELYTLAISRFDIPGDAGFPLNGIYTKP----EDPE 123
            .||||||..|:|.:||..|...||.::..:.|..:|:..|.:||..|||||.:|..|    ...:
Yeast    66 ADRVLIYGILFINDCLAHLKITTSFNEAVKVLTNVALDNFTLPGTPGFPLNNVYQVPVQDHNSMD 130

  Fly   124 LMRQYFLQLRQETGNRLLEKVFDTPDGK--PSKWWICFAKKKFMEKSL 169
            |::.|..|.|||...||||:|:.:.|.|  |||:|:.|.:::||.|||
Yeast   131 LLKTYIQQFRQELAMRLLERVYSSTDSKEYPSKFWLAFTRRRFMNKSL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc3BNP_573193.1 P21-Arc 1..169 CDD:281983 76/176 (43%)
ARC18NP_013474.3 P21-Arc 1..178 CDD:397948 76/176 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346833
Domainoid 1 1.000 152 1.000 Domainoid score I919
eggNOG 1 0.900 - - E1_KOG3155
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I1111
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54322
OrthoFinder 1 1.000 - - FOG0004013
OrthoInspector 1 1.000 - - otm46584
orthoMCL 1 0.900 - - OOG6_102731
Panther 1 1.100 - - O PTHR12391
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2769
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.