DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc3B and Arpc3

DIOPT Version :9

Sequence 1:NP_573193.1 Gene:Arpc3B / 32696 FlyBaseID:FBgn0065032 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_062798.1 Gene:Arpc3 / 56378 MGIID:1928375 Length:178 Species:Mus musculus


Alignment Length:177 Identity:108/177 - (61%)
Similarity:136/177 - (76%) Gaps:4/177 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAFHSEIEDFQAS-VGNMALLPLRTQVRGPAPTVDIPNDIIDESLYFWKSNIFFRTYEVKSEVD 64
            |||:||.:.|.... :|||||||||:|.:||||......||:||::|::|:|:||:.||:|:|.|
Mouse     1 MPAYHSSLMDPDTKLIGNMALLPLRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEAD 65

  Fly    65 RVLIYITLYITECLKRLARCTSKSQGQQELYTLAISRFDIPGDAGFPLNGIYTKP---EDPELMR 126
            |.||||||||:||||:|.:|.|||||::|:|||.|:.|.|||:.|||||.||.||   ::.|:||
Mouse    66 RTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPASKQEDEMMR 130

  Fly   127 QYFLQLRQETGNRLLEKVFDTPDGKPSKWWICFAKKKFMEKSLSGPG 173
            .|..|||||||.||.|||||....||||||.||.|::||.|||||||
Mouse   131 AYLQQLRQETGLRLCEKVFDPQSDKPSKWWTCFVKRQFMNKSLSGPG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc3BNP_573193.1 P21-Arc 1..169 CDD:281983 102/171 (60%)
Arpc3NP_062798.1 P21-Arc 1..173 CDD:397948 102/171 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850870
Domainoid 1 1.000 230 1.000 Domainoid score I2444
eggNOG 1 0.900 - - E1_KOG3155
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 240 1.000 Inparanoid score I3333
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54322
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004013
OrthoInspector 1 1.000 - - otm42657
orthoMCL 1 0.900 - - OOG6_102731
Panther 1 1.100 - - O PTHR12391
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2769
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.