DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc3B and Arpc3A

DIOPT Version :9

Sequence 1:NP_573193.1 Gene:Arpc3B / 32696 FlyBaseID:FBgn0065032 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_650498.3 Gene:Arpc3A / 41917 FlyBaseID:FBgn0038369 Length:177 Species:Drosophila melanogaster


Alignment Length:176 Identity:130/176 - (73%)
Similarity:159/176 - (90%) Gaps:3/176 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAFHSEIEDFQASVGNMALLPLRTQVRGPAPTVDIPNDIIDESLYFWKSNIFFRTYEVKSEVDR 65
            |||:||:|::.:..|||||:||||||||||||:.:|.:||||||||::|:|:||||||:||:|||
  Fly     1 MPAYHSQIKEVRQQVGNMAILPLRTQVRGPAPSANIESDIIDESLYYFKANVFFRTYEIKSDVDR 65

  Fly    66 VLIYITLYITECLKRLARCTSKSQGQQELYTLAISRFDIPGDAGFPLNGIYTKP---EDPELMRQ 127
            ||||:|||||||||:|.|.|||:||||::|:||||:||||||||||||.:|.||   :|.:||||
  Fly    66 VLIYVTLYITECLKKLNRSTSKAQGQQDMYSLAISKFDIPGDAGFPLNAVYAKPQTAQDADLMRQ 130

  Fly   128 YFLQLRQETGNRLLEKVFDTPDGKPSKWWICFAKKKFMEKSLSGPG 173
            |.||||.|||||:|||||:|.||||:|||.||||||||||||:|||
  Fly   131 YLLQLRHETGNRVLEKVFNTEDGKPNKWWTCFAKKKFMEKSLAGPG 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc3BNP_573193.1 P21-Arc 1..169 CDD:281983 125/170 (74%)
Arpc3ANP_650498.3 P21-Arc 1..172 CDD:397948 125/170 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473290
Domainoid 1 1.000 140 1.000 Domainoid score I1535
eggNOG 1 0.900 - - E1_KOG3155
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I1794
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54322
OrthoDB 1 1.010 - - D1451115at2759
OrthoFinder 1 1.000 - - FOG0004013
OrthoInspector 1 1.000 - - otm24590
orthoMCL 1 0.900 - - OOG6_102731
Panther 1 1.100 - - P PTHR12391
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2769
1211.810

Return to query results.
Submit another query.