DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc3B and arpc3

DIOPT Version :9

Sequence 1:NP_573193.1 Gene:Arpc3B / 32696 FlyBaseID:FBgn0065032 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001002114.1 Gene:arpc3 / 415204 ZFINID:ZDB-GENE-040625-107 Length:178 Species:Danio rerio


Alignment Length:177 Identity:103/177 - (58%)
Similarity:134/177 - (75%) Gaps:4/177 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAFHSEIEDFQAS-VGNMALLPLRTQVRGPAPTVDIPNDIIDESLYFWKSNIFFRTYEVKSEVD 64
            |||:||.:.|.... |||||||||:||.:|||.......|||||::|::|:|:||:.||:|:|.|
Zfish     1 MPAYHSALMDADTKLVGNMALLPLKTQFKGPAARETKDTDIIDEAIYYFKANVFFKNYEIKNEAD 65

  Fly    65 RVLIYITLYITECLKRLARCTSKSQGQQELYTLAISRFDIPGDAGFPLNGIYTKP---EDPELMR 126
            |.||||||||:||||:|.:|:|:.||::|:|||.|:.|.|||:.|||||.:|.||   ::.|.||
Zfish    66 RTLIYITLYISECLKKLQKCSSRGQGEKEMYTLGITNFPIPGEPGFPLNAMYAKPSSKQEEENMR 130

  Fly   127 QYFLQLRQETGNRLLEKVFDTPDGKPSKWWICFAKKKFMEKSLSGPG 173
            .|..|:|||||.||.::|||....||||||:||.||:||.||||.||
Zfish   131 AYLQQIRQETGLRLCDRVFDPQTDKPSKWWVCFVKKQFMNKSLSAPG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc3BNP_573193.1 P21-Arc 1..169 CDD:281983 98/171 (57%)
arpc3NP_001002114.1 P21-Arc 1..173 CDD:281983 98/171 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596922
Domainoid 1 1.000 221 1.000 Domainoid score I2541
eggNOG 1 0.900 - - E1_KOG3155
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 228 1.000 Inparanoid score I3442
OMA 1 1.010 - - QHG54322
OrthoDB 1 1.010 - - D1451115at2759
OrthoFinder 1 1.000 - - FOG0004013
OrthoInspector 1 1.000 - - otm24590
orthoMCL 1 0.900 - - OOG6_102731
Panther 1 1.100 - - O PTHR12391
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2769
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.