DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc3B and arx-5

DIOPT Version :9

Sequence 1:NP_573193.1 Gene:Arpc3B / 32696 FlyBaseID:FBgn0065032 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_499667.1 Gene:arx-5 / 176697 WormBaseID:WBGene00000203 Length:183 Species:Caenorhabditis elegans


Alignment Length:182 Identity:85/182 - (46%)
Similarity:120/182 - (65%) Gaps:9/182 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAFHS----EIEDFQASVGNMALLPLRTQVRGPAPTVDIPNDIIDESLYFWKSNIFFRTYEVKS 61
            |||:||    |::.......||..||:||..:||||..: .:|||||:|.::|.|||||.:|:|.
 Worm     1 MPAYHSKFDTELKVLPLGNTNMGKLPIRTNFKGPAPQTN-QDDIIDEALTYFKPNIFFREFEIKG 64

  Fly    62 EVDRVLIYITLYITECLKRLARCTSKSQGQQELYTLAISR-FDIPGDAGFPLNGIYTKPE---DP 122
            ..||.:||:..||||||::|.:..:|..||::|:.||:|. ..|||:.|||||.:|..|:   |.
 Worm    65 PADRTMIYLIFYITECLRKLQKSPNKIAGQKDLHALALSHLLPIPGENGFPLNSMYKAPQSKPDE 129

  Fly   123 ELMRQYFLQLRQETGNRLLEKVFDTPDGKPSKWWICFAKKKFMEKSLSGPGM 174
            :.||.|..|:|||.|.||.:..|..|..:|||||:|||:::||:|.|.|.|:
 Worm   130 DEMRAYLQQIRQEIGARLCDLAFPDPQDRPSKWWLCFARRRFMDKGLVGQGV 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc3BNP_573193.1 P21-Arc 1..169 CDD:281983 82/175 (47%)
arx-5NP_499667.1 P21-Arc 1..176 CDD:281983 82/175 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167991
Domainoid 1 1.000 180 1.000 Domainoid score I2090
eggNOG 1 0.900 - - E1_KOG3155
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 184 1.000 Inparanoid score I2617
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54322
OrthoDB 1 1.010 - - D1451115at2759
OrthoFinder 1 1.000 - - FOG0004013
OrthoInspector 1 1.000 - - otm14548
orthoMCL 1 0.900 - - OOG6_102731
Panther 1 1.100 - - O PTHR12391
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2769
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.