DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4991 and AT5G02170

DIOPT Version :9

Sequence 1:NP_001259638.1 Gene:CG4991 / 32695 FlyBaseID:FBgn0030817 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_195837.2 Gene:AT5G02170 / 831896 AraportID:AT5G02170 Length:526 Species:Arabidopsis thaliana


Alignment Length:418 Identity:92/418 - (22%)
Similarity:171/418 - (40%) Gaps:65/418 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 GAGLFAMGDCFKNGGLAGATILLPIIAVMCVHCERMLIRGSVLAVERTPGVDFLDYPETVEKCFE 163
            |..|..|....|.||..|..||.. ..::..:...:|.|    .:|.:||:.  .||:..:..| 
plant   150 GVALLTMPYAVKEGGWLGLFILFS-FGIITFYTGILLKR----CLENSPGIH--TYPDIGQAAF- 206

  Fly   164 HGPRPLRKMSRVMKLIVEMFLCVTQFGFCAIYFVFITENLHQV-----LQQNGIVISMSMVMLIT 223
                     ....:::|.:.|.|..:..|..|.:.:::||.::     |..||..:..:.|..||
plant   207 ---------GTTGRILVSILLYVELYASCVEYIIMMSDNLSRMFPNTSLYINGFSLDSTQVFAIT 262

  Fly   224 LLPAMIPSL----MTNLKYISPVSLFANVALLFGLIATLTIAFSDGPMPSVGDRHLFTGGA---- 280
            ....::|::    ::.|.|:|...:.:::.|...|       |..|.:..|| .|: :|.|    
plant   263 TTLIVLPTVWLKDLSLLSYLSAGGVISSILLALCL-------FWAGSVDGVG-FHI-SGQALDIT 318

  Fly   281 QLALFFGTALFSYEGIALILPLRNSMRRPEKFSTRFGVLNSTMFFTTALFIFTGFVSYVRWGEEV 345
            .:.:..|...|.:...::...:.:||:.|.||.|   ||..:..|.|..:|......:..:|:.:
plant   319 NIPVAIGIYGFGFGSHSVFPNIYSSMKEPSKFPT---VLLISFAFCTLFYIAVAVCGFTMFGDAI 380

  Fly   346 AGSITLNLVVEEVFSQVVKVIAALGVFLGYPIQFFVMIKILWPPLKRSNNCTQKYPITSQVCLRF 410
            ....|||:......|::....|.:.....|.:....::..|...:..|:...:...::  :..|.
plant   381 QSQFTLNMPPHFTSSKIAVWTAVVTPMTKYALTITPVMLSLEELIPSSSRKMRSKGVS--MLFRT 443

  Fly   411 FMVMMTFGVALVVPKLNLFISLIGALCSTCLAFVIPVLIDF------VTRAQVPKALGVWSYIKN 469
            .:|:.|..|||.||......:|||:..:..:|.:.|.|...      :|..|:           .
plant   444 ILVLSTLVVALTVPFFATVAALIGSFIAMLIALIFPCLCYISIMKGRLTNFQI-----------G 497

  Fly   470 ILILTVAVLGIVT---GTYQSIVEIVKE 494
            |.|| :.::|||:   |||.:|..::.|
plant   498 ICIL-IVIIGIVSGCCGTYSAIARLIGE 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4991NP_001259638.1 SLC5-6-like_sbd 82..489 CDD:294310 90/411 (22%)
SdaC 84..488 CDD:223884 90/410 (22%)
AT5G02170NP_195837.2 SLC5-6-like_sbd 136..495 CDD:320982 80/375 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.