DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4991 and slc38a3a

DIOPT Version :9

Sequence 1:NP_001259638.1 Gene:CG4991 / 32695 FlyBaseID:FBgn0030817 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001092235.1 Gene:slc38a3a / 100073328 ZFINID:ZDB-GENE-070615-25 Length:189 Species:Danio rerio


Alignment Length:133 Identity:27/133 - (20%)
Similarity:51/133 - (38%) Gaps:21/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AGEMGRTLEITGRQNDKS-LEKNPERFTKNVTEKGADPENGDPVRRRGHETSELEAAT------- 91
            |||......|..:..|.: .::.......|:.|......|.|.  ::....::.|..|       
Zfish    17 AGEETTATAIKSQSEDAAHTDRTAGNVEANLVESSEFLSNADD--KKTPRFTDFEGKTSFGMSVF 79

  Fly    92 HLFKGSVGAGLFAMGDCFKNGGLAGATILLPIIAVMCVHCERMLIRGS----VLAVER------- 145
            :|....:|:|:..:.....|.|:....|||.::|.:..:...:|::.|    :.|.|:       
Zfish    80 NLGNAIMGSGILGLAYAMANTGIVLFVILLTVVAGLSAYSIHLLLKSSGVVGIRAYEQLGYRAFG 144

  Fly   146 TPG 148
            |||
Zfish   145 TPG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4991NP_001259638.1 SLC5-6-like_sbd 82..489 CDD:294310 18/85 (21%)
SdaC 84..488 CDD:223884 18/83 (22%)
slc38a3aNP_001092235.1 SLC5-6-like_sbd 70..>182 CDD:294310 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594526
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 1 1.010 - - D697331at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.