DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16700 and Slc32a1

DIOPT Version :9

Sequence 1:NP_573191.1 Gene:CG16700 / 32694 FlyBaseID:FBgn0030816 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_113970.1 Gene:Slc32a1 / 83612 RGDID:621402 Length:525 Species:Rattus norvegicus


Alignment Length:426 Identity:96/426 - (22%)
Similarity:179/426 - (42%) Gaps:71/426 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GLFAMG--DAFKNGGLLVAPLLTVVIAVVSIHCQHVLVTC---------SKKMRD---LKGDSVC 121
            |:|.:|  .|..:||.| ...|.:..|||..:...:|:.|         ..::||   ...::.|
  Rat   131 GMFVLGLPYAILHGGYL-GLFLIIFAAVVCCYTGKILIACLYEENEDGEVVRVRDSYVAIANACC 194

  Fly   122 ADYAQTVEQCFENGPSKLRGWSRTMGRLVDIFICVTQLGFCCIYFVFISTNLKQILQAYD----I 182
            |....|:.                 ||:|:: ..:.:|...||.:|.:|.||     .|:    :
  Rat   195 APRFPTLG-----------------GRVVNV-AQIIELVMTCILYVVVSGNL-----MYNSFPGL 236

  Fly   183 DMNVHLVMLLAFVPVLLSSLITNLKWLTPVSMFANVCMILGLAITLY---YALKDGLPEVEERA- 243
            .::.....::|...:|..:.:.|||   .||.|:.:|.:....|.:.   |.|........|:. 
  Rat   237 PVSQKSWSIIATAVLLPCAFLKNLK---AVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVK 298

  Fly   244 LWTNGSQLALFFGTAIFAFEGIALVMPLKNAMRKPHQFERPLGVLNVGMFLVSVMFMFAGSVGYM 308
            .:.:..:..:..|..:|::.....:..|:..|::|.:|...:...::...::..:|..   |.|:
  Rat   299 FYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFAL---VAYL 360

  Fly   309 KWGEQVGGSLTLNLGDTILAQAVKLMVSAGVLLGYPLQFFVAIQIMWPNAKQ--------MC-GI 364
            .|.::....:|.||..:|.| .|.:.:.|..||.|||.||.|::::..:..|        .| |.
  Rat   361 TWADETKEVITDNLPGSIRA-VVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPACYGG 424

  Fly   365 EGRSLLGELGFRTFMVLVTLAIAEMVPALGLFISLIGALCSTALALVFPPV--IELISRSELNKG 427
            :||.....|..|..:|:.||.:|..||...|.:.|.|:|....|..:.|.:  :.|:.|..|   
  Rat   425 DGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRLLWRKLL--- 486

  Fly   428 PGIWICV-KNLVILVLALLGFFTGSYESLKQIVKHF 462
               |..| .::.|.|:..:...:|...||:.:::.:
  Rat   487 ---WHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAY 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16700NP_573191.1 SLC5-6-like_sbd 53..452 CDD:294310 94/414 (23%)
SdaC 57..452 CDD:223884 94/414 (23%)
Slc32a1NP_113970.1 Aa_trans 115..512 CDD:279788 94/417 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352530
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.