DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16700 and AT5G02180

DIOPT Version :9

Sequence 1:NP_573191.1 Gene:CG16700 / 32694 FlyBaseID:FBgn0030816 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001331278.1 Gene:AT5G02180 / 831862 AraportID:AT5G02180 Length:550 Species:Arabidopsis thaliana


Alignment Length:409 Identity:91/409 - (22%)
Similarity:168/409 - (41%) Gaps:57/409 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GPGLFAMGDAFKNGGLLVAPLLTVVIAVVSIHCQHVLVTCSKKMRDLKGDSVCADYAQTVEQCFE 133
            |.||..|..|.|..|.|..|:| :...|::.:...::..|   :....|.....|..|.      
plant   174 GLGLITMPYAIKESGWLGLPIL-LFFGVITCYTGVLMKRC---LESSPGIQTYPDIGQA------ 228

  Fly   134 NGPSKLRGWSRTMGRLVDIFICVTQLGFCCIYFVFISTNLKQILQ--AYDIDMNVHLVMLLAFVP 196
                   .:..|...::.|.:.|.....|..|.:.:|.||..:..  :..|...:.|.....|. 
plant   229 -------AFGITGRFIISILLYVELYAACVEYIIMMSDNLSGLFPNVSLSIASGISLDSPQIFA- 285

  Fly   197 VLLSSLITNLKWLTPVSMFANV-------CMILGLAITLYYALKDGLPEVEERALWTNG-----S 249
            :|.:.|:....||..:|:.:.:       .::||:.: .:....||:      .....|     |
plant   286 ILTTLLVLPTVWLKDLSLLSYLSVGGVLASILLGICL-FWVGAVDGI------GFHATGRVFDLS 343

  Fly   250 QLALFFGTAIFAFEGIALVMPLKNAMRKPHQFERPLGVLNVGMFLVSVMFMFAGSVGYMKWGEQV 314
            .|.:..|...|.:.|.::...:.::|:.|.:|  || ||.:.....:|:::.....||..:||.|
plant   344 NLPVTIGIFGFGYSGHSVFPNIYSSMKDPSRF--PL-VLVICFSFCTVLYIAVAVCGYTMFGEAV 405

  Fly   315 GGSLTLNLGDTILAQAVKLMVSA-GVLLGYPL---QFFVAIQIMWPNAKQMCGIEGRSLLGELGF 375
            ....|||:........|.:..:. ..:..|.|   ...::::.:.|.||...  .|.|:|    |
plant   406 ESQFTLNMPKHFFPSKVAVWTAVITPMTKYALTITPIVMSLEELIPTAKMRS--RGVSIL----F 464

  Fly   376 RTFMVLVTLAIAEMVPALGLFISLIGALCSTALALVFPPVIEL-ISRSELNKGPGIWICVKNLVI 439
            ||.:|..||.:|..||...:..:|||:..:..:||:||.:..| |.:.:|: ...|.:|:   .|
plant   465 RTMLVTSTLVVALSVPFFAIVAALIGSFLAMLVALIFPCLCYLSILKGKLS-NTQIGLCI---FI 525

  Fly   440 LVLALLGFFTGSYESLKQI 458
            :|..::....|:|.::.::
plant   526 IVFGVVSGCCGTYSAISRL 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16700NP_573191.1 SLC5-6-like_sbd 53..452 CDD:294310 90/401 (22%)
SdaC 57..452 CDD:223884 90/401 (22%)
AT5G02180NP_001331278.1 SLC5-6-like_sbd 160..542 CDD:320982 91/405 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.