DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16700 and mah

DIOPT Version :9

Sequence 1:NP_573191.1 Gene:CG16700 / 32694 FlyBaseID:FBgn0030816 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_651316.1 Gene:mah / 42988 FlyBaseID:FBgn0285912 Length:527 Species:Drosophila melanogaster


Alignment Length:480 Identity:95/480 - (19%)
Similarity:165/480 - (34%) Gaps:157/480 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LLTVVIAVVSIHCQHVLVTCSKKMRDLKGDSVCA----DYAQTVEQCFENGPSKLRGWSRTMGRL 149
            ||.:.|.::.|:...:|..| ..|.:|...|:..    .||...|..:  ||        .|..|
  Fly    99 LLVLSIIILQIYTSFLLSQC-WTMAELLDPSIQQKRNYPYAALAELAY--GP--------YMSLL 152

  Fly   150 VDIFICVTQLGFCCIYFVFISTNLKQI---LQAYDIDMNVHLVMLLAFVPVLLSSLITNLKWL-T 210
            |.:.:.::.........|..:.||:.:   :.|...:.:      ..:..:::..:|..|.|| :
  Fly   153 VSVLLDLSIFAMAVPSVVMAAQNLEGVVLRMSAGQYNFS------YCYWAIIVGLVICPLMWLGS 211

  Fly   211 PVSM----FANVCMILGLAITLYYALKDGLPEVEERALWTNGSQLALFFGTAI-FAFEGIALVMP 270
            |..|    ...||:::.:...|::                     .||...|| ..||||:|.:|
  Fly   212 PKHMRGLAIIAVCVMIVIVALLWF---------------------CLFAAPAIGTPFEGISLELP 255

  Fly   271 -----LKNAMRKPHQFE-RP-LGVLNVGMFLVSVMFMFAGSVGYMKWGEQVGGSLTLNL---GDT 325
                 |.:......||: .| |..|.:.|...|          .:.|...:|.::|.::   |..
  Fly   256 GFLTVLNSYSILAFQFDIHPVLLTLQIDMKQKS----------QVSWAALIGIAITCSVAIFGSI 310

  Fly   326 ILAQAVKLMVSAGVLLGYP--LQFFVAIQIMWPNAKQMC------------GIEGRSLLGE-LGF 375
            |.|.....|::..:|...|  :.|:|.:.:|   |.|:|            .||....|.| |.|
  Fly   311 IAAYKFGSMIADNLLQSLPTSVPFYVMLILM---ALQLCFSVTVASSAMFMQIENYFKLPESLSF 372

  Fly   376 -----RTFMVLVTLAIAEMVPALGLFISLIGALCSTALALVFPPVI-ELISRSE----------- 423
                 |:.::.:.:.:||.||:....:.::|...:..|..:.||:: ..|.|.|           
  Fly   373 KRMLIRSSVLALEVLVAEFVPSFDALMDVVGGTITGPLVFILPPLLYRRIRRMERVHQRIAAEAS 437

  Fly   424 -------LNKGP------------------GIWI--------------CVKNLVIL--------- 440
                   ||..|                  |.|:              |...::|.         
  Fly   438 YGSLPLDLNYDPVDLEMEPLLVISPPTTPRGCWLRFVRLLHRLECDVSCTMAVLIFGLLATFLST 502

  Fly   441 ---VLALLGFFTGSYESLKQIVKHF 462
               :.:|...||.:...|..:.|||
  Fly   503 YLNIFSLASLFTNNSPCLSNLTKHF 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16700NP_573191.1 SLC5-6-like_sbd 53..452 CDD:294310 91/468 (19%)
SdaC 57..452 CDD:223884 91/468 (19%)
mahNP_651316.1 SLC5-6-like_sbd 110..426 CDD:294310 76/366 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468311
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.