DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16700 and CG30394

DIOPT Version :9

Sequence 1:NP_573191.1 Gene:CG16700 / 32694 FlyBaseID:FBgn0030816 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_611578.1 Gene:CG30394 / 37437 FlyBaseID:FBgn0050394 Length:831 Species:Drosophila melanogaster


Alignment Length:429 Identity:90/429 - (20%)
Similarity:181/429 - (42%) Gaps:71/429 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IVHLFKGNIGPGLFAMGDAFKNGGLLVAPLLTVVIAVVSIHCQHVLVTCSKKMRDLKGDSVCADY 124
            ::.|....||.|:.||...|:..|:|::.:|.|:...::..|.|.|:..|...|           
  Fly     8 VMTLANSIIGVGILAMPFCFQKCGILLSIVLLVLSNGITRVCCHYLIKTSLLTR----------- 61

  Fly   125 AQTVEQCFENGPSKLRGWSRTMGR-LVDIFICVTQLGFCCIYFVFISTNLKQILQ---AYDIDMN 185
                .:.||.......|   |.|: ||::.|....:|.|..|||.:.....||:.   |.|:..:
  Fly    62 ----RRSFEMLGLHAFG---TSGKLLVELCIIGYLIGTCITYFVVVGDLGPQIIAKIFALDVADH 119

  Fly   186 VHL-------VMLLAFVPVLLSSLITNLKWLTPVSMFANVCMILGLAITLYYALKDGLPEVEERA 243
            :||       |.::..||:.:...:.:|..:...|:...||:||.:.:       :..|.:....
  Fly   120 LHLRSLVMVVVTVVCIVPLGMLRNVDSLSAVCTASIGFYVCLILKIVL-------EAQPHITAND 177

  Fly   244 LWTNGSQLALFFGTAIFAFEGIALVMP-----LKNAMRKPHQFE--------RPLGVLNVGMFLV 295
             ||   :..|::..|     |:...:|     |...|:....||        :..|::....::.
  Fly   178 -WT---EKVLYWEPA-----GVLQCLPIFSMALSCQMQLFEVFESINNQSLDKLNGIVRNATWIC 233

  Fly   296 SVMFMFAGSVGYMKW-GEQVGGSLTLNLGDTILAQAVKLMVSAGVLLGYPLQFFVAIQIMWPNAK 359
            :.:::..|..||:.: .....|::.:||..:..:..:|:.....:...:||..|.....::....
  Fly   234 TFVYISVGFFGYVAFCTHTFSGNILVNLSTSFGSDIIKIGFVLSIAFSFPLVIFPCRASLYSLLY 298

  Fly   360 QMCGIEGRSLLGELGFR---TFMVLVTLAIAEMVPALGLFISLIGALCSTALALVFP--PVIELI 419
            :....|..|.:.|..||   .|:|:.:|.:|.::|::.|.|.|:|:....|:.::||  ...::|
  Fly   299 RKGHTESSSYIPEQRFRFITIFIVVFSLCVALVIPSVELIIGLVGSTIGVAICIMFPASSFRKII 363

  Fly   420 SRSELNKGPGIWICVKNLVILVLALLGFFTGSYESLKQI 458
            .:..:.:....::.|...::::|       |:|.:|..|
  Fly   364 KKESMERTLAQFVFVSGFLLMIL-------GTYANLSAI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16700NP_573191.1 SLC5-6-like_sbd 53..452 CDD:294310 87/421 (21%)
SdaC 57..452 CDD:223884 87/421 (21%)
CG30394NP_611578.1 SdaC 8..392 CDD:223884 88/424 (21%)
SLC5-6-like_sbd 8..390 CDD:294310 87/422 (21%)
DUF4775 <394..652 CDD:292620 1/2 (50%)
YukC <561..660 CDD:295067
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468289
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22950
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.