DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16700 and slc38a6

DIOPT Version :9

Sequence 1:NP_573191.1 Gene:CG16700 / 32694 FlyBaseID:FBgn0030816 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001018308.1 Gene:slc38a6 / 336741 ZFINID:ZDB-GENE-050522-51 Length:449 Species:Danio rerio


Alignment Length:424 Identity:96/424 - (22%)
Similarity:173/424 - (40%) Gaps:56/424 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TSYLETIVHLFKGNIGPGLFAMGDAFKNGGLLVAPLLTVVIAVVSIHCQH-VLVTCSKKMRDLKG 117
            :|::.:..:|....:|.|:..:..|..|.|.:...:|.:::|.::.:..| :|:.|.|       
Zfish    38 SSFMSSAFNLMNAIMGSGILGLSYAMANTGTVGFSILLLMVASLAAYSIHLLLLLCDK------- 95

  Fly   118 DSVCADYAQTVEQCFENGPSKLRGWSRTMGRLVDIFICVTQLGFCCIYFVFISTNLKQILQAYD- 181
             :....|....|:.. |.|.|:         ||...|.:..:|....|...:.|.|...:..:. 
Zfish    96 -TGINSYEALGEKAL-NRPGKI---------LVACTILIQNIGAMSSYLFILKTELPAAIIGFMR 149

  Fly   182 ---------IDMNVHLVMLLAFVPVLLSSLITNLKWLTPVSMFANVCMILGLAITLY--YALKDG 235
                     .:..|.|::|:..:.||..:|:..:.:|...|..|.:.|:....:.:.  :::...
Zfish   150 SDSETSGKWFENGVTLLILVTVIIVLPLALLPKIGFLGYTSSIAFLFMLFFTVVVVVKKWSIPCP 214

  Fly   236 LPEVEERALWTN-----------GSQLALFFGTAIFAFEGIALVMPLKNAMRKPHQFERPLGVLN 289
            ||.....:|..|           .|:.|....|..|:|.....|.|:...:.:|.: .|.....|
Zfish   215 LPINSTLSLSLNTSECTAQLFVISSKSAYAVPTMAFSFLCHTAVFPIYCELHRPTK-RRMQRATN 278

  Fly   290 VGMFLVSVMFMFAGSVGYMKWGEQVGGSLTL----NLGDTILAQAVKLMVSAGVLLGYPLQFFVA 350
            |.:||..|:::.:...||:.:...||..|.|    .|...||..:|:|.:...|||..||..|.|
Zfish   279 VSIFLSFVVYLISALFGYLTFYSHVGSELLLAYNTYLPRDILVMSVRLAILLAVLLTVPLIHFPA 343

  Fly   351 IQIMWPNAKQMC-GIEGRSLLGELGFRTFMVLVTLAIAEMVPALGLFISLIGALCSTALALVFPP 414
            .:.:    ..:| |....|.|.......|::.:.|.:|..||.:.....::|:..||.|..|:|.
Zfish   344 RKAV----LMLCRGEREFSWLSHTLSCFFILTLVLLLAIFVPDIKNVFGVVGSTTSTCLLFVYPG 404

  Fly   415 VIELISRSE----LNKGPGIWICVKNLVILVLAL 444
            :..|...||    .|....:::.|..||:.||:|
Zfish   405 MFFLRISSEPIRSFNSVGAVFLLVIGLVVGVLSL 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16700NP_573191.1 SLC5-6-like_sbd 53..452 CDD:294310 96/424 (23%)
SdaC 57..452 CDD:223884 95/421 (23%)
slc38a6NP_001018308.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
SLC5-6-like_sbd 36..443 CDD:294310 96/424 (23%)
SdaC 37..442 CDD:223884 96/424 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594510
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 1 1.010 - - D697331at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.