DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16700 and slc38a3a

DIOPT Version :9

Sequence 1:NP_573191.1 Gene:CG16700 / 32694 FlyBaseID:FBgn0030816 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001092235.1 Gene:slc38a3a / 100073328 ZFINID:ZDB-GENE-070615-25 Length:189 Species:Danio rerio


Alignment Length:192 Identity:39/192 - (20%)
Similarity:72/192 - (37%) Gaps:37/192 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PN----QLEKNQTATVPRQETAEGGSTGETAVGGAAAKVT-----------KEQDHDAEYHPPTS 55
            ||    :..:..|||..:.::.:...|..|| |...|.:.           |:.....::...||
Zfish    10 PNGKGHEAGEETTATAIKSQSEDAAHTDRTA-GNVEANLVESSEFLSNADDKKTPRFTDFEGKTS 73

  Fly    56 YLETIVHLFKGNIGPGLFAMGDAFKNGGLLVAPLLTVVIAVVSIHCQHVLVTCSKKMRDLKGDSV 120
            :..::.:|....:|.|:..:..|..|.|:::..:|..|:|.:|.:..|:|         ||...|
Zfish    74 FGMSVFNLGNAIMGSGILGLAYAMANTGIVLFVILLTVVAGLSAYSIHLL---------LKSSGV 129

  Fly   121 CA--DYAQTVEQCFENGPSKLRGWSRTMGRLVDIFICVTQLGFCCIYFVFISTNLKQILQAY 180
            ..  .|.|...:.| ..|.|:         ...|.|.:..:|....|...:......::||:
Zfish   130 VGIRAYEQLGYRAF-GTPGKM---------AAGIAITLQNIGAMSSYLYIVKYEFPLVIQAF 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16700NP_573191.1 SLC5-6-like_sbd 53..452 CDD:294310 28/130 (22%)
SdaC 57..452 CDD:223884 26/126 (21%)
slc38a3aNP_001092235.1 SLC5-6-like_sbd 70..>182 CDD:294310 28/131 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 1 1.010 - - D697331at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.