DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and Cpn1

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:XP_011245709.1 Gene:Cpn1 / 93721 MGIID:2135874 Length:463 Species:Mus musculus


Alignment Length:293 Identity:72/293 - (24%)
Similarity:120/293 - (40%) Gaps:87/293 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1083 PMTWNRYHNHDEIVKYLETVRMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIK 1147
            |:|: |:|.:|::|:.|..|..:.|.:..|.:||||.:||.|.|::.        ::..|:|...
Mouse    20 PVTF-RHHRYDDLVRTLYKVHNQCPDITRLYNIGRSVKGRYLYVLEF--------SDYPGIHEPL 75

  Fly  1148 RPKRKRKSG-QANAVFVEAGAQGLAWIGPAAATWMIAELLRLMKTNKSNEDVEFIRNTTWYIMPV 1211
            .|:.|.... ..|.|.   |.:.|.         .::|.|.....|::...:..|::|..:|:|.
Mouse    76 EPEVKYVGNMHGNEVL---GRELLL---------QLSEFLCEEFRNRNQRILRLIQDTRIHILPS 128

  Fly  1212 LNPDGYAYSHEYDRFWKKSRSQHQTPPPSGLLDSAMTWLQQKRGPDKVCY--------GVDLDRN 1268
            :|||||          :.:.:|..:|               :.||:...|        ||||:||
Mouse   129 MNPDGY----------EVAAAQVHSP---------------REGPNMSGYLVGRNNANGVDLNRN 168

  Fly  1269 ------WLYHWGKRGSSKAPCNEFYAGPAPFS-----EPETKAVSEFLMDYRTQIKLYISLQAYG 1322
                  :.|:..|.|   .|.:..   |.|.:     ||||:||.:::    ..:...:|...:|
Mouse   169 FPDLNTYFYYNSKNG---GPNHHL---PLPDNWKSQVEPETRAVIQWI----RSLNFVLSANMHG 223

  Fly  1323 --QVISYPVK---------ANSTFNSERLDDFL 1344
              .|.:||..         .:.|.||...||.|
Mouse   224 GAVVANYPYDKSLEHRFRGPHRTSNSPTPDDEL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416
M14_CP_A-B_like 1089..1430 CDD:199844 69/287 (24%)
Cpn1XP_011245709.1 Peptidase_M14_like 25..343 CDD:386095 69/287 (24%)
Peptidase_M14NE-CP-C_like 347..421 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4063
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.