| Sequence 1: | NP_573190.1 | Gene: | CG8945 / 32693 | FlyBaseID: | FBgn0030815 | Length: | 1430 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_003906.2 | Gene: | CPNE1 / 8904 | HGNCID: | 2314 | Length: | 542 | Species: | Homo sapiens |
| Alignment Length: | 212 | Identity: | 40/212 - (18%) |
|---|---|---|---|
| Similarity: | 67/212 - (31%) | Gaps: | 97/212 - (45%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1193 KSNEDVEFIR-------------------NTTW--YIMPVL-----NP-------------DGYA 1218
Fly 1219 YSHEYDRFWKKSRSQHQTPPP------------------SGLL-------DSAMTWLQQKRGPDK 1258
Fly 1259 VCYGVDLDRNWLYHWGKRGSSKAPCNEFYAGPAPFSEPETKAVSEFLMDYRTQIKLYISLQAYGQ 1323
Fly 1324 VISYPVKANSTFNSERL 1340 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8945 | NP_573190.1 | Propep_M14 | 988..1058 | CDD:280416 | |
| M14_CP_A-B_like | 1089..1430 | CDD:199844 | 40/212 (19%) | ||
| CPNE1 | NP_003906.2 | C2A_Copine | 11..129 | CDD:176013 | |
| C2B_Copine | 143..250 | CDD:176012 | 20/90 (22%) | ||
| vWA_copine_like | 256..514 | CDD:238736 | 20/115 (17%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S4063 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.950 | |||||