DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and AGBL4

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:XP_011540610.1 Gene:AGBL4 / 84871 HGNCID:25892 Length:531 Species:Homo sapiens


Alignment Length:415 Identity:72/415 - (17%)
Similarity:130/415 - (31%) Gaps:188/415 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly  1083 PMTWNRYHNHDEIVKYLETVRMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIK 1147
            |.|:.|:.:      ||::::.|:........:|:|.:.|.|                 .|.||.
Human   180 PYTYTRFQH------YLDSLQKRNMDYFFREQLGQSVQQRKL-----------------DLLTIT 221

  Fly  1148 RPKRKRKSGQANAVFVEA-----------------------------GAQGLAWIGPAAATWMIA 1183
            .|...|:..:...||:..                             .:.|:.|:.|....::::
Human   222 SPDNLREGAEQKVVFITGRVHPGETPSSFVCQGIPPGHWAALSSSFQNSPGIHWMSPGIIDFLVS 286

  Fly  1184 E-----LLRLMKTNKSNEDVEFIRNTTWYIMPVLNPDGYAYSHEYDRFWKKSRSQHQTPPPSGLL 1243
            :     :||           |::   .:.|.|:||||| .|...|.                   
Human   287 QHPIACVLR-----------EYL---VFKIAPMLNPDG-VYLGNYR------------------- 317

  Fly  1244 DSAMTWLQQKRGPDKVC--YGVDLDRNWLYHWGKRGSSKAPCNEFYAGPAPFSEPETKAVSEFLM 1306
                            |  .|.||:|:||                  .|:|:..|....|.:.::
Human   318 ----------------CSLMGFDLNRHWL------------------DPSPWVHPTLHGVKQLIV 348

  Fly  1307 ----DYRTQIKLYISLQAYGQVISYPVKANSTFNSERL--------------DDF--------LD 1345
                |.:|.::.||.:.|:..:::..:..|...:.||.              :||        .|
Human   349 QMYNDPKTSLEFYIDIHAHSTMMNGFMYGNIFEDEERFQRQAIFPKLLCQNAEDFSYSSTSFNRD 413

  Fly  1346 VAMVGTDGLRKKGSKSRYKVDASNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGYLLP-S 1409
            ....|| |.|..|.           |::..|.|              |||:::   .:.|::. :
Human   414 AVKAGT-GRRFLGG-----------LLDHTSYC--------------YTLEVS---FYSYIISGT 449

  Fly  1410 SAIEPTARDAF-----EIISGMLDY 1429
            :|..|...:|:     .:....|||
Human   450 TAAVPYTEEAYMKLGRNVARTFLDY 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416
M14_CP_A-B_like 1089..1430 CDD:199844 69/409 (17%)
AGBL4XP_011540610.1 M14_AGBL4_like 190..475 CDD:133118 68/399 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.