DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and AT5G42320

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001332683.1 Gene:AT5G42320 / 834237 AraportID:AT5G42320 Length:430 Species:Arabidopsis thaliana


Alignment Length:380 Identity:81/380 - (21%)
Similarity:146/380 - (38%) Gaps:106/380 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1068 LQTTRPSKPRPTAPPPMTWNRYHNHDEIVKYLETVRMRHPQ--LVELIHIGRSFEGRPLIVVKIE 1130
            |..|.||.  .:...|:.|:.||:.|::::.:.::..|||.  .:|||..|.......:.||   
plant    26 LGETNPSD--SSFVTPINWDLYHSSDDLMEQIHSLVHRHPDKLSIELIKSGNKGYNAEVNVV--- 85

  Fly  1131 SKQTAAAANNDGLHTIKRPKRKRKSGQANAVFVEAGAQGLAWIGPAAATWMIAELLRLMKTNK-- 1193
                          |..|..::........:.:..|..|...|    .:.:...:|.::...:  
plant    86 --------------TYCRGGKESDDRSNFRILLTFGQHGRELI----TSELAFRILSILSEEQFL 132

  Fly  1194 SNEDVEFIRNT----TWYIMPVLNPDGYAYSHEYDRFWKKSRSQHQTPPPSGLLDSAMTWLQQKR 1254
            .|::...::||    ...::|:.||:|            :.|.:      ||.|      .:::.
plant   133 PNKNGGILKNTLDKLVIKMVPIENPNG------------RKRVE------SGDL------CERRN 173

  Fly  1255 GPDKVCYGVDLDRNWLYHWGKRGSSKAPCNEFYAGPAPFSEPETKAVSEFLMDYRTQIKLYISLQ 1319
            |     .||||:|||...|||:.....|..| ..|.||||||||:.:.:..:.:...|  :|::.
plant   174 G-----RGVDLNRNWGVDWGKKEKDYDPSEE-NPGTAPFSEPETQIMRKLAISFDPHI--WINVH 230

  Fly  1320 AYGQVISYPV-KANSTFNS----------ERLDDF--LDVAMVGTDGLRKKGSKSRYKVDASNDL 1371
            :..:.:..|. ..|.|...          |:|:.|  .|..|:|:.|    ||........:.|.
plant   231 SGMEALFMPYDHKNITPEGLPSQKMRTLLEKLNKFHCHDRCMIGSGG----GSVGYLAHGTATDY 291

  Fly  1372 IEQRSGCADAFAAYE-IGIPFSYTLQL-ADNGVHGYLLPSSAIEPTARDAFEIIS 1424
            |            |: :..|.::|.:: .||            :..:||.|::.:
plant   292 I------------YDVVKAPMAFTFEIYGDN------------QTASRDCFKMFN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416
M14_CP_A-B_like 1089..1430 CDD:199844 75/359 (21%)
AT5G42320NP_001332683.1 M14-CPA-like 100..321 CDD:349446 61/284 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524270at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.