DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and Cpo

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:XP_038940238.1 Gene:Cpo / 689717 RGDID:1588771 Length:325 Species:Rattus norvegicus


Alignment Length:366 Identity:77/366 - (21%)
Similarity:131/366 - (35%) Gaps:105/366 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1085 TWNRYHNHDE-IVKYLETVRMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKR 1148
            :::|||.... |.:::..|..::.:::....:..::|..|:..:| ||.:.:..::|        
  Rat    21 SYDRYHPWGRGIYQWMRQVSEKYAEVLTQHFLRMTYETWPMHYLK-ESAEISLTSSN-------- 76

  Fly  1149 PKRKRKSGQANAVFVEAGAQGLAWIGPAAATWMIAE---LLRLMKTNKSNEDVEFIRNTTWYIMP 1210
                    ....::::.|.....||.||...|.:.|   ...|:..|.:.|.:..:.::..|..|
  Rat    77 --------SKKTIWIDCGIHASRWIAPAFCQWFLREGSVFTCLLMLNHAIEYLSTLGSSETYFFP 133

  Fly  1211 ---------------------------------VLNPDGYAYSHEYDRFWKKSRSQHQTPPPSGL 1242
                                             |||.|| .|:  :...|        |.|.   
  Rat   134 VNWNGIQLAPLQILQNDKDSARIGRLLKELDFXVLNADGXIYT--WTTAW--------TLPV--- 185

  Fly  1243 LDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGKRGSSKAPCNEF-YAGPAPFSEPETKAVSEFLM 1306
                        |...:|..:....|              |.:. :.|..|..|||. ..|:.|.
  Rat   186 ------------GQGYLCLHIGTPIN--------------CQDVTFCGIEPMLEPEL-TPSQALQ 223

  Fly  1307 DYR--TQIKLYISLQAYGQVISYPV--KANSTFNSERLDDFLDVAMVGTDGLRKKGSKSRYKVDA 1367
            ..|  ..|..::.:.:|||:|..|.  ..|...|.|.|   :.|.......|:.|.. :.|:|.:
  Rat   224 KARGKKDILCFLIMGSYGQLILTPYGHTKNKPHNYEEL---IQVGQKAARALKAKHG-TNYRVGS 284

  Fly  1368 SNDLIEQRSGCADAFAAYEIGIP-FSYTLQLADNGVHGYLL 1407
            ..|::...||.:..:.. .|||| ||||.:|.|||.||:.|
  Rat   285 GADILYMLSGSSKDWNG-GIGIPLFSYTFELVDNGTHGFAL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416
M14_CP_A-B_like 1089..1430 CDD:199844 76/362 (21%)
CpoXP_038940238.1 Peptidase_M14_like 22..324 CDD:416253 76/363 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.