DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and agbl2

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:XP_017209580.1 Gene:agbl2 / 568152 ZFINID:ZDB-GENE-070719-6 Length:1025 Species:Danio rerio


Alignment Length:377 Identity:75/377 - (19%)
Similarity:133/377 - (35%) Gaps:104/377 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 DLEPAEESETLEEQEPLQSDEQLNLRIRRSVE------DVRREKRRGPLHAKKRNSSLKALI--- 435
            |.:||:.:..|||...|...| :..::.|.|:      |:..|......::.:.:.....|:   
Zfish   606 DPDPAKMTRCLEELGVLLKQE-IRRKLGREVDSLENLSDIDIESSTSGSNSTESDGLPVHLLNVT 669

  Fly   436 ---KKSVLKNAVKRARLLKNQGEMDSSRTQ-HRRSRRSLYSIKNGEIEKSIKTEKATKVPSEEAE 496
               ||.:|::..:|.||  .||.:.|:..: .:|:.:.|..:.:.|....::.::.|....::|:
Zfish   670 NQGKKKLLRSRKERNRL--RQGRVQSAGPKIFQRNIKHLDPVPSNEDAVKVRIQEKTTCYVKDAK 732

  Fly   497 KEVTADSTKRSQKVVSKESKTILSRG----NPNVVAAR--RVSTPKRRSPKGSSGRR-------- 547
            |:....|.:.:|.|.|.........|    .|::...|  ::| |......|.|..|        
Zfish   733 KQKVPCSGRANQTVRSWIPHPTTHIGVIDNVPDIWENRLDKIS-PATNLHNGFSAFRHSVSVDHG 796

  Fly   548 -KTKQQTPPSTQKKEKNSGGVLHIPTALHLLHRNHSQDEVPKVPLNANQKKKRKVKERKRGRPQL 611
             ||.|....|..:      |.|...|  ||:..:|.:  .|.||.:         :||....| :
Zfish   797 HKTYQNATSSAPQ------GQLQRQT--HLVAGSHKR--CPSVPAS---------QERTLTMP-V 841

  Fly   612 PSFDIFELMSDGDYEDEGEEEEEEQDDDEDYYFEDEHKDEDKNKPNESSSTEVGQSDLKED---- 672
            ||:.:                        .:|.|...:.|.|.:|:.|:.....|..|:::    
Zfish   842 PSYTM------------------------SFYPEFRPQPELKGRPHISNIMARSQQKLRQERQMQ 882

  Fly   673 ------------------------SSSAEEGADFGAMVEEETTTTATISSSE 700
                                    ...|..||.|.:...|:|.....||..|
Zfish   883 VNHIPVKHLMPLHNMGTLRISHKTDGQAGAGAGFASPNTEQTRRANQISKQE 934

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416
M14_CP_A-B_like 1089..1430 CDD:199844
agbl2XP_017209580.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.