DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and Cpa4

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001102816.1 Gene:Cpa4 / 502736 RGDID:1563619 Length:421 Species:Rattus norvegicus


Alignment Length:455 Identity:124/455 - (27%)
Similarity:206/455 - (45%) Gaps:63/455 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   982 DKY---QIWRLKPQDEEQVRALEEFKKGEDGVKLQWLKGPS-LRGLTDVLVPPKMLVDFQGTLNY 1042
            ||:   |::|:..::.:::|.|.|. ...|..||...|.|| .....|:|||...|:..:..|..
  Rat    19 DKFFGDQVFRINVRNGDEIRKLTEL-VNSDHFKLNVWKSPSTFDRPVDILVPSVSLLPVKSFLKS 82

  Fly  1043 EGIAHEVLIFDVGKAIAYELTKEDYLQTTRPSKPRPTAPPPMTWNRYHNHDEIVKYLETVRMRHP 1107
            :|:.:.|.| |..:|:   |..||........:.|   .....:..||:.:.|...::::....|
  Rat    83 QGLDYSVTI-DNLQAL---LDIEDEEMQHNEGRER---SGDFNYGSYHSPEAIYHEMDSIATDFP 140

  Fly  1108 QLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKRKRKSGQANAVFVEAGAQGLAW 1172
            .|...:.||.:||.||:.|:|..:          |....|||          |:::.||.....|
  Rat   141 DLASRVKIGETFEKRPMYVLKFST----------GGGGKKRP----------AIWLNAGIHAREW 185

  Fly  1173 IGPAAATWMIAELLRLMKTNKSNEDVEFIRNTTWYIMPVLNPDGYAYSHEYDRFWKKSRSQHQTP 1237
            |..|.|.|...::  :....|.......:.....:::||.|||||.|:...:|.|:|:||     
  Rat   186 ISQATAIWTARKI--VTDYQKDPAVTSILEKMDIFLLPVANPDGYVYTQNQNRLWRKTRS----- 243

  Fly  1238 PPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGKRGSSKAPCNEFYAGPAPFSEPETKAVS 1302
                            |.|...|.|.|.:|||...:...|:|..||:|.|.|..|.||.|.|:|.
  Rat   244 ----------------RNPGSRCIGADPNRNWNASFAGEGASNNPCSEVYHGSHPNSEVEVKSVV 292

  Fly  1303 EFLMDYRTQIKLYISLQAYGQVISYP--VKANSTFNSERLDDFLDVAMVGTDGLRKKGSKSRYKV 1365
            :|:..: ...|.:|.|.:|.|::.||  .......::|.|||....|......|    |.::|:|
  Rat   293 DFIQKH-GNFKCFIDLHSYSQLLMYPYGYSVKKAPDAEELDDVARSAAKALASL----SGTKYQV 352

  Fly  1366 DASNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGYLLPSSAIEPTARDAFEIISGMLDYI 1430
            ..:...:...||.:..: ||:.||.:::|.:|.|.|.:|:|||:|.|.|||.:.::.:..:::::
  Rat   353 GPTCTTVYPASGSSVDW-AYDNGIKYAFTFELRDTGHYGFLLPASQIIPTAEETWQGLKVIMEHV 416

  Fly  1431  1430
              Rat   417  416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 20/70 (29%)
M14_CP_A-B_like 1089..1430 CDD:199844 96/342 (28%)
Cpa4NP_001102816.1 Propep_M14 28..99 CDD:280416 21/75 (28%)
Peptidase_M14_like 117..419 CDD:299699 96/349 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.