DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and CG8560

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster


Alignment Length:449 Identity:125/449 - (27%)
Similarity:210/449 - (46%) Gaps:60/449 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   980 SYDKYQIWRLKPQD--EEQVRALEEFKKGEDGVKLQWLKGPSLRGLTDVLVPPKMLVDFQGTLNY 1042
            :||.|:|:.:..::  |:|:.......:..|...|.    .||...:.|:|.|:....|:..|..
  Fly    20 NYDGYKIYDINARNAFEKQLLLRLSGNEAYDFFDLP----RSLDASSRVMVKPEDQEGFEHLLEK 80

  Fly  1043 EGIAHEVLIFDVGKAIAYELTKEDYLQTTRPSKPRPTAPPPMTWNRYHNHDEIVKYLETVRMRHP 1107
            .|:.:.|:..:.|:::..|   .|..|..|....| :|...:::..:|.|.||..||:.:...:|
  Fly    81 YGVNYSVINENFGESLRQE---RDENQNQRLMNLR-SAERSVSFKAFHRHAEINAYLDELAAAYP 141

  Fly  1108 QLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKRKRKSGQANAVFVEAGAQGLAW 1172
            ..|.:...|:|:|.|.:        :|....|.||           |:|: |.||::||.....|
  Fly   142 SRVSVQVAGKSYENRDI--------KTITITNGDG-----------KTGK-NVVFLDAGIHAREW 186

  Fly  1173 IGPAAATWMIAELLRLMKTNKSNEDVEFIRNTTWYIMPVLNPDGYAYSHEYDRFWKKSRSQHQTP 1237
            |..|.|.::|.:|:.....|.     |.:::..|.|:||:|||||.|||...|.|:|:|..    
  Fly   187 IAHAGALYVIHQLVENFAANS-----ELLKDFDWVILPVVNPDGYEYSHTTTRMWRKTRKP---- 242

  Fly  1238 PPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGKRGSSKAPCNEFYAGPAPFSEPETKAVS 1302
                 :.||             |||.|.:||:.:|||:.|:|...|::.:.|...||||||:.:.
  Fly   243 -----ISSA-------------CYGTDANRNFDFHWGEVGASSYSCSDTFKGETAFSEPETQLIR 289

  Fly  1303 EFLMDYRTQIKLYISLQAYGQVISYPVKANSTFNSERLDDFLDVAMVGTDGLRKKGSKSRYKVDA 1367
            :.|:....:.|.|::|.:||..:.||....|...|...|:. :||..|.|.: |..:.::|.|.:
  Fly   290 DILLSLTGRGKFYLTLHSYGNYLLYPWGWTSALPSSWRDND-EVAQGGADAI-KSATGTKYTVGS 352

  Fly  1368 SNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGYLLPSSAIEPTARDAFEIISGM 1426
            |.:::...:|.:|.:|......|.|.|::|...|. |:...:|.||....:.:..|..|
  Fly   353 STNVLYAAAGGSDDYAFGVANFPVSITMELPAGGT-GFNPSTSQIEGFVSETWVGIKAM 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 14/71 (20%)
M14_CP_A-B_like 1089..1430 CDD:199844 101/338 (30%)
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416 14/72 (19%)
M14_CP_A-B_like 123..414 CDD:199844 101/338 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.