DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and CG32379

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster


Alignment Length:383 Identity:101/383 - (26%)
Similarity:161/383 - (42%) Gaps:90/383 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1041 NYEGIAHEVLIFDVGKAI----AYELTKEDYLQTTRPSKPRPTAPPPMTW------NRYHNHDEI 1095
            ||. :.::|||.|:...:    |..|.|:..:|                |      :.::.|.||
  Fly     3 NYH-LEYKVLIEDLAPLVHAQRAENLRKKLLIQ----------------WPHIDVLSAFYTHSEI 50

  Fly  1096 VKYLETVRMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKRKRKSGQANA 1160
            ..||:::..|.|:.|::...|.|:|.|||.|:.|        .|.||        |:.|.    .
  Fly    51 NDYLDSLLERFPKRVQVKQFGWSYERRPLKVLTI--------TNGDG--------RRNKP----V 95

  Fly  1161 VFVEAGAQGLAWIGPAAATWMIAELLRLMKTNKSNEDVEFIRNTTWYIMPVLNPDGYAYSHEYDR 1225
            :.::.......||.|:.|.::|.:||     :...::.|.:::..|.||||:|.|||.|:|...|
  Fly    96 ILIDGTVHAREWISPSMALYIIQQLL-----DNYGDNQELLQDYDWVIMPVVNADGYEYTHTDSR 155

  Fly  1226 FWKKSRSQHQTPPPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWG-KRGSSKAPCNEFYAG 1289
            :|:|||.....|.                     |.|.|::||:.|.|| ..|||..||...|.|
  Fly   156 YWRKSRRPTSNPE---------------------CIGTDINRNFGYEWGHDEGSSSDPCENIYRG 199

  Fly  1290 PAPFSEPETKAVSEFLMDYRTQIKLYISLQAYGQVISYPVKANSTFNSERLDDFLDVAMVG---- 1350
            ..||.:.|::.:.:.::.|:.::..|:||.:||.....|....|.| .:...|.:.||..|    
  Fly   200 ERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSDF-PDTYQDMMSVADAGAKAI 263

  Fly  1351 ---TDGLRKKGSKSRYKVDASNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGY 1405
               |:|:...||........|.|..:...|..:|..|        .|::|...|..|:
  Fly   264 IYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATVA--------MTMELPAAGFQGF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 6/16 (38%)
M14_CP_A-B_like 1089..1430 CDD:199844 90/325 (28%)
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 90/325 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.