DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and cpa1

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001018318.1 Gene:cpa1 / 325886 ZFINID:ZDB-GENE-050522-438 Length:418 Species:Danio rerio


Alignment Length:457 Identity:122/457 - (26%)
Similarity:214/457 - (46%) Gaps:64/457 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   978 RISYDKYQIWRLKPQDEEQVRALEEFKKGEDGVKLQWLKGPSLRGL-TDVLVPPKMLVDFQGTLN 1041
            :::::..|:.|:..::.||:..|:|..:. |.:.|.:...|:...| .|:.||...|...:..|.
Zfish    17 KVTFEGDQVLRINAKNAEQISLLKELTEA-DLLGLDFWMNPARESLPVDLHVPFHSLQAVRAFLA 80

  Fly  1042 YEGIAHEVLIFDVGKAIAYELTKEDYLQTTR-PSKPRPTAPPPMTWNRYHNHDEIVKYLETVRMR 1105
            |..|.:.::|.:|     .:|..::.||..: ...||.|  ....:..||:.|.|..:::.:...
Zfish    81 YNQIPYHIMIENV-----QDLVDKEQLQMLKYHGFPRST--DDFVYTTYHDLDSINLFMDMLVAE 138

  Fly  1106 HPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKRKRKSGQANAVFVEAGAQGL 1170
            :..:|..|.||:|:|.|||.|:|.     :..||..|                  ::::.|....
Zfish   139 NQNMVSKIEIGQSYENRPLNVLKF-----STGANRPG------------------IWIDTGLHSR 180

  Fly  1171 AWIGPAAATWMIAELLRLMKTNKSNEDV--EFIRNTTWYIMPVLNPDGYAYSHEYDRFWKKSRSQ 1233
            .||..|:..|...:::    |:...:.|  :.:.:...::..|.||||.||:|..||.|:|:|  
Zfish   181 EWITHASGIWFAKKIV----TDYGRDPVLTDILNSYDIFLEIVANPDGLAYTHSDDRMWRKTR-- 239

  Fly  1234 HQTPPPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGKRGSSKAPCNEFYAGPAPFSEPET 1298
                               |..|...|.|||.:|||...:|..|||..||::.|.||:..||||.
Zfish   240 -------------------KPNPGSSCVGVDPNRNWETGFGGPGSSSNPCSQTYHGPSIHSEPEV 285

  Fly  1299 KAVSEFLMDYRTQIKLYISLQAYGQVISYPVKANSTFNSERLDDFLDVAMVGTDGLRKKGSKSRY 1363
            ||:.||:..: ..:|.::|:.:|.|::.||.....|...::. :..::|...|..|:.. ..:.|
Zfish   286 KAIVEFVKSH-GNLKAFLSIHSYSQMLLYPYGYTQTAAKDQA-ELHELARKATSELQSL-YNTAY 347

  Fly  1364 KVDASNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGYLLPSSAIEPTARDAFEIISGMLD 1428
            ...:....|.|..|....: |||.||.:|||.:|.|.|.:|::||:..|.|||.:.:..:..:::
Zfish   348 TYGSIITTIYQADGVTTDW-AYEQGIKYSYTFELRDTGRYGFILPADQILPTAEETWLALMVIME 411

  Fly  1429 YI 1430
            :|
Zfish   412 HI 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 18/70 (26%)
M14_CP_A-B_like 1089..1430 CDD:199844 96/342 (28%)
cpa1NP_001018318.1 Propep_M14 27..99 CDD:280416 19/77 (25%)
Peptidase_M14_like 117..416 CDD:299699 97/349 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.