DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and cpb1

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001315354.1 Gene:cpb1 / 322412 ZFINID:ZDB-GENE-030131-1132 Length:416 Species:Danio rerio


Alignment Length:454 Identity:114/454 - (25%)
Similarity:207/454 - (45%) Gaps:74/454 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   985 QIWRLKPQDEEQVRALEEFKKGEDGVKLQWLKGP------SLRGLTDVLVPPKMLVDFQGTLNYE 1043
            ::.:|||.::|.|..:.|.  ||. :||.:.| |      |:....|:.||...|......|...
Zfish    24 KVLQLKPINDEHVTIIREL--GEK-IKLDFWK-PRSADLVSIDMTVDIHVPAAQLAMVSTILQQS 84

  Fly  1044 GIAHEVLIFDVGKAIAYELTKEDYLQTTRPSKPRPTAPPPMTWNRYHNHDEIVKYLETVRMRHPQ 1108
            .:..:|:|.::.:|:      :..:....|:|..       .:.:|::...|..:..::...:|.
Zfish    85 DMEVKVMIDNLQEAV------KGQMDNRSPTKGH-------DYTKYNSWATINDWAISISSANPD 136

  Fly  1109 LVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKRKRKSGQANAVFVEAGAQGLAWI 1173
            |:....||.::|||.:.::|| .|.|.:          .:|          |||::.|.....||
Zfish   137 LISRQSIGNTYEGRTMHLLKI-GKNTGS----------NKP----------AVFMDCGFHAREWI 180

  Fly  1174 GPAAATWMIAELLRLMKTNKSNEDV-EFIRNTTWYIMPVLNPDGYAYSHEYDRFWKKSRSQHQTP 1237
            ..|...|.:.|   .:.|..|:.|: ..:....::::||.|.|||.|:...||.|:|:||::   
Zfish   181 THAFCQWFVNE---AVSTYGSDPDMTNLLDRMDFFVLPVFNIDGYEYTWNRDRMWRKTRSKN--- 239

  Fly  1238 PPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGKRGSSKAPCNEFYAGPAPFSEPETKAVS 1302
              ||                ..|.|.|.:||:...|...|:|..||::.|.|.:|.||.|:|.::
Zfish   240 --SG----------------SSCIGTDPNRNFNAGWCTVGASSNPCSDTYCGSSPESEIESKNLA 286

  Fly  1303 EFLMDYRTQIKLYISLQAYGQVISYPVKANSTFNSERLDDFLDVAMVGTDGLRK-KGSKSRYKVD 1366
            .|:...::.||.|:::.:|.|::.:|........:.. .:.:.|:......||. .|:|  |...
Zfish   287 NFIRTNKSVIKAYLTVHSYSQLLLFPYSYKYDLAAHH-SELMSVSQGAIAALRSLYGTK--YTSG 348

  Fly  1367 ASNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGYLLPSSAIEPTARDAFEIISGMLDYI 1430
            .....|...:|.:|.: ||::|:.:|||.:|.|.|.:|:|||.|.|:||..:....:..:.:::
Zfish   349 PGAATIYPAAGGSDDW-AYDLGVKYSYTFELRDEGRYGFLLPESQIKPTCEETMLAVKYIANHV 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 20/75 (27%)
M14_CP_A-B_like 1089..1430 CDD:199844 91/342 (27%)
cpb1NP_001315354.1 M14_CPB 112..412 CDD:199852 91/356 (26%)
Propep_M14 27..99 CDD:280416 20/75 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.