DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and CG42264

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster


Alignment Length:483 Identity:135/483 - (27%)
Similarity:209/483 - (43%) Gaps:116/483 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   981 YDKYQIWRLKPQ--DEEQVRAL------EEFKKGEDGVKLQWLKGPSLRGLTDVLVPPKMLVDFQ 1037
            |..:|:|::...  ::.::||.      |.:...:||:              |:|:..:.:.|.:
  Fly   220 YYGFQLWKVHETRLEQPELRAFWRHFGSEVWNINQDGI--------------DILIEQRNVADAR 270

  Fly  1038 GTLNYEGIAHEVLIFDVGKAIAYELTKEDYLQTTRPSKP----RPTAPP-------PMTWNRYHN 1091
            ..::..|.::.::|.|:..||     .|.|::......|    |..:.|       .|.|.|||:
  Fly   271 KFMDKVGYSYNIMIDDIESAI-----DESYVEVPAVEHPLDSVRNNSLPWMEVPGSTMNWRRYHD 330

  Fly  1092 HDEIVKYLETVRMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKRKRKSG 1156
            ..:|.::|:|:...:.:.||||.||.:...|||.|:::.:      .|.|..             
  Fly   331 QADIKQFLQTLLETYSENVELIQIGVTRNKRPLEVIRVSN------GNPDNW------------- 376

  Fly  1157 QANAVFVEAGAQGLAWIGPAAATWMIAELLRLMKTNKSNEDVE---------FIRNTTWYIMPVL 1212
               ||||:||.|...|:.|||.|:.|::|..|....|..:..|         .:|...||.:|:.
  Fly   377 ---AVFVDAGLQARDWLSPAALTYAISKLTHLWGRPKGKDKGEGQRQSRAEKAMRRIDWYFLPLA 438

  Fly  1213 NPDGYAYSHEYDRFWKKSRSQHQTPPPSGLLDSAMTWLQQKRGPDKV--CYGVDLDRNWLYHWGK 1275
            |||||.||.:.||.|.|:                       ||.|.|  ||||:||||:.|.|..
  Fly   439 NPDGYQYSRQTDRLWTKN-----------------------RGYDSVSGCYGVNLDRNFDYGWDG 480

  Fly  1276 RGSSKAPCNEFYAGPAPFSEPETKAVSEFLMDYRTQIKLYISLQAYGQVISYPVKANSTFNSERL 1340
            .||:..||...|.|...|||||::||..||...|..:..|:||..|||.|:|| ..::.:.:|..
  Fly   481 TGSTSNPCKNLYRGAHSFSEPESRAVCSFLSGMREYLGAYVSLGGYGQAITYP-WGDADYVTENQ 544

  Fly  1341 DDFLDVAMVGTDGLRK-------KGSKSRYKV---DASNDLIEQRSGCADAFAAYEIGIPFSYTL 1395
            .:....|......||:       .|:..|.|:   ..|.|.::.|           ||....:.:
  Fly   545 RNLKQTARRAVLALRRLNQAEYSSGTSYRQKLARPGNSADWVQDR-----------IGPQLVFNM 598

  Fly  1396 QLADNGVHGYLLPSSAIEPTARDAFEII 1423
            .|.|.|.:|||||...|..:..:.||.:
  Fly   599 FLKDQGRYGYLLPPHYIVESGEEVFEFL 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 11/77 (14%)
M14_CP_A-B_like 1089..1430 CDD:199844 111/356 (31%)
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416 11/70 (16%)
M14_CP_A-B_like 328..633 CDD:199844 111/356 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.