DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and cpa5

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_954965.1 Gene:cpa5 / 246092 ZFINID:ZDB-GENE-020514-1 Length:419 Species:Danio rerio


Alignment Length:464 Identity:120/464 - (25%)
Similarity:216/464 - (46%) Gaps:83/464 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   980 SYDKYQIWRLKPQDEEQVRALEEF-KKGED-GVKLQWLKGPSLRGL-TDVLVPPKMLVDFQGTLN 1041
            :::..|::|:.|:||.|:..|:|. ::||. |:.: |:: |.|..| .|:.||...|...:..|.
Zfish    19 TFEGDQVFRITPKDEAQIDLLKELTEEGEHLGLSV-WME-PILESLPLDLHVPFHSLQAVRAFLA 81

  Fly  1042 YEGIAHEVLIFDVGKAIAYE-----------LTKEDYLQTTRPSKPRPTAPPPMTWNRYHNHDEI 1095
            |..|.:.::|.:|.:.:..|           .:.:|::.||                 ||:.:.|
Zfish    82 YNQIPYHIMIENVQELLDDEQRDMVKYRGLARSTDDFVYTT-----------------YHDLNSI 129

  Fly  1096 VKYLETVRMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKRKRKSGQANA 1160
            ..:::.:...:..:|..:.||:|:|.|||.|:|.     :..||..|                  
Zfish   130 NSFMDMLVAENRNMVSKVVIGQSYEKRPLNVLKF-----STGANRPG------------------ 171

  Fly  1161 VFVEAGAQGLAWIGPAAATWMIAELLRLMKTNKSNEDVEFIRNTTWYIMPVLNPDGYAYSHEYDR 1225
            ::::.|.....|:..|:..|...::::....:....|:  :.:...::..|.||||:.|:|..||
Zfish   172 IWIDTGIHSREWVTQASGVWFAKKIVKDYGRDPVLTDI--LNSHDIFLEIVTNPDGFVYTHTKDR 234

  Fly  1226 FWKKSRSQHQTPPPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGKRGSSKAPCNEFYAGP 1290
            .|:|:|                     |..|...|.|||.:|||...:|..|||..||.|.|.||
Zfish   235 MWRKTR---------------------KPNPGSSCVGVDPNRNWDAGFGGGGSSNNPCTETYRGP 278

  Fly  1291 APFSEPETKAVSEFLMDYRTQIKLYISLQAYGQVISYPVKANSTFNSERLDDFLDVAMVGTDGLR 1355
            :..||||.||:.:|:..: .:||.::|:.:|.|::.||.....|...::. :..:||......|:
Zfish   279 SAHSEPEVKAIVDFVKSH-GKIKAFVSIHSYSQMLLYPYGYTYTAAKDKA-ELHEVARKAITSLQ 341

  Fly  1356 KKGSKSRYKVDASNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGYLLPSSAIEPTARDAF 1420
            .. ..:||...:....|.|.||....: .|..||.:|||.:|.|.|.:|::||::.|.|||.:.:
Zfish   342 SL-YNTRYTYGSIITTIYQASGGTIDW-TYNQGIKYSYTFELRDTGRYGFILPANQIVPTAEETW 404

  Fly  1421 EIISGMLDY 1429
            ..:..::::
Zfish   405 LALMAIMEH 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 23/72 (32%)
M14_CP_A-B_like 1089..1430 CDD:199844 92/341 (27%)
cpa5NP_954965.1 Propep_M14 27..100 CDD:280416 23/74 (31%)
Peptidase_M14_like 118..417 CDD:299699 94/363 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.