DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and F02D8.4

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_506684.3 Gene:F02D8.4 / 179994 WormBaseID:WBGene00008521 Length:448 Species:Caenorhabditis elegans


Alignment Length:341 Identity:96/341 - (28%)
Similarity:160/341 - (46%) Gaps:52/341 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1088 RYHNHDEIVKYLETVRMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKRK 1152
            ||.::||.:|:|.::..::|..|:|.:||.|:|||.:..|:|.         :||   ..:|   
 Worm   118 RYLSYDEQMKFLNSLAQQYPNDVKLQNIGNSYEGRSITAVRIA---------DDG---SSKP--- 167

  Fly  1153 RKSGQANAVFVEAGAQGLAWIGPAAATWMIAELLRLMKTNKSNEDVEFIRNTTWYIMPVLNPDGY 1217
                   .|:::||.....||....|.::|..::.........:.|:.:      ::|..|||||
 Worm   168 -------IVWIDAGIHAREWISYNVALYLIYTIVSQPAYRNLLDSVQLV------VVPNTNPDGY 219

  Fly  1218 AYSHEYDRFWKKSRSQHQTPPPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGKRGSSKAP 1282
            .||...||.|:|:||                     |..:..|.|.|.:||:.::||.:|.|.:.
 Worm   220 EYSRTNDRMWRKTRS---------------------RFTNSRCAGADANRNYPFYWGTQGVSHSQ 263

  Fly  1283 CNEFYAGPAPFSEPETKAVSEFLMDYRTQIKLYISLQAYGQVISYPVKANSTFNSERLDDFLDVA 1347
            |:|.:.|..|.||||..|::..::....:||.||:|.:|||.|.||...........:.|.:.|.
 Worm   264 CSEIFCGSRPQSEPEVLALTNAIIRDEERIKGYIALHSYGQEILYPWGHTQRTYPTDVQDLIQVG 328

  Fly  1348 MVGTDGLRKKGSKSRYKVDASNDLIEQRSGCADAFAAYEIGIPFSYTLQLAD-NGVHGYLLPSSA 1411
            ......:|.. :.:.|.|..|.|.:...:|.:|.:|... ||.:|||::|:. :...|:.||...
 Worm   329 RAMASAIRAV-NNTDYTVVNSGDGLYPAAGASDDWAKSR-GIKYSYTIELSPIDDFTGFSLPEDR 391

  Fly  1412 IEPTARDAFEIISGML 1427
            |....|:||:.|..::
 Worm   392 INQVCREAFQAIQVLM 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416
M14_CP_A-B_like 1089..1430 CDD:199844 95/340 (28%)
F02D8.4NP_506684.3 M14_CP_A-B_like 119..407 CDD:349433 95/338 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.