DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and CPA3

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001861.2 Gene:CPA3 / 1359 HGNCID:2298 Length:417 Species:Homo sapiens


Alignment Length:476 Identity:133/476 - (27%)
Similarity:218/476 - (45%) Gaps:87/476 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   967 TTTTSRPDVPRRISYDKYQIWRLKPQDEEQVRALEEFKKGEDGVKLQ-WLKGPSLRGLTDVLVPP 1030
            ||....|     :.:|:.:::|:|||||:|...:::..|..:   |. |..|.:..      |..
Human    12 TTLAIAP-----VRFDREKVFRVKPQDEKQADIIKDLAKTNE---LDFWYPGATHH------VAA 62

  Fly  1031 KMLVDF----------QGTLNYEGIAHEVLIFDVGKAIAYEL-TKEDYLQTTRPSKPRPTAPPPM 1084
            .|:|||          |..|:...:.:|:||.|:.:.|..:. .|||             .|...
Human    63 NMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKED-------------IPGRH 114

  Fly  1085 TWNRYHNHDEIVKYLETVRMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRP 1149
            ::.:|:|.::||.:.|.:..::|::|..|.||.:.|..||.|:||..|                 
Human   115 SYAKYNNWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEK----------------- 162

  Fly  1150 KRKRKSGQANAVFVEAGAQGLAWIGPAAATWMIAELLRLMKTNKSNEDVEFIRNTTWYIMPVLNP 1214
            ..:||     |:|.:.|.....|:.||...|.:.:..:....||..  .:.:....:||:||.|.
Human   163 NERRK-----AIFTDCGIHAREWVSPAFCQWFVYQATKTYGRNKIM--TKLLDRMNFYILPVFNV 220

  Fly  1215 DGYAYSHEYDRFWKKSRSQHQTPPPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGKRGSS 1279
            |||.:|...:|.|:|:||::|                     :..|.|.||:||:...|....::
Human   221 DGYIWSWTKNRMWRKNRSKNQ---------------------NSKCIGTDLNRNFNASWNSIPNT 264

  Fly  1280 KAPCNEFYAGPAPFSEPETKAVSEFLMDYRTQIKLYISLQAYGQVISYPVKANSTFNSERLDDFL 1344
            ..||.:.|.|.||.||.|||||:.|:..:..:||:||:..:|.|::.:|....|...... :|..
Human   265 NDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGYTSKLPPNH-EDLA 328

  Fly  1345 DVAMVGTDGLRKKGSKSRYKVDASNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGYLLPS 1409
            .||.:|||.|..: .::||........|...||.:..: ||::||..::..:|.|.|..|:|||.
Human   329 KVAKIGTDVLSTR-YETRYIYGPIESTIYPISGSSLDW-AYDLGIKHTFAFELRDKGKFGFLLPE 391

  Fly  1410 SAIEPTARDAFEIISGMLDYI 1430
            |.|:||.|:....:..:..||
Human   392 SRIKPTCRETMLAVKFIAKYI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 22/80 (28%)
M14_CP_A-B_like 1089..1430 CDD:199844 100/340 (29%)
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 23/82 (28%)
M14_CPB 114..413 CDD:199852 102/347 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.