DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and Cpa3

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_031779.1 Gene:Cpa3 / 12873 MGIID:88479 Length:417 Species:Mus musculus


Alignment Length:476 Identity:130/476 - (27%)
Similarity:213/476 - (44%) Gaps:87/476 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   967 TTTTSRPDVPRRISYDKYQIWRLKPQDEEQVRALEEFKKGEDGVKLQ-WLKGPSLRGLTDVLVPP 1030
            ||....|     :.:|:.:::|:|.|:|:....|:...:   .::|. |...    .:.|:.|  
Mouse    12 TTLAIAP-----VHFDREKVFRVKLQNEKHASVLKNLTQ---SIELDFWYPD----AIHDIAV-- 62

  Fly  1031 KMLVDF----------QGTLNYEGIAHEVLIFDVGKAIAYELTKEDYLQTTRPSKPRPTAPPPMT 1085
            .|.|||          |.||....|.:|:||.|:.:.|..:...:|.:....            :
Mouse    63 NMTVDFRVSEKESQTIQSTLEQHKIHYEILIHDLQEEIEKQFDVKDEIAGRH------------S 115

  Fly  1086 WNRYHNHDEIVKYLETVRMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPK 1150
            :.:|::.|:||.:.|.:..:||::|..|.||.:.|..||.|:||                     
Mouse   116 YAKYNDWDKIVSWTEKMLEKHPEMVSRIKIGSTVEDNPLYVLKI--------------------- 159

  Fly  1151 RKRKSGQANAVFVEAGAQGLAWIGPAAATWMIAELLRLMKTNKSNEDVEFIRNTTWYIMPVLNPD 1215
             .:|.|:..|:|::.|.....||.||...|.:.:..:....||..  .:.:....:|::||.|.|
Mouse   160 -GKKDGERKAIFMDCGIHAREWISPAFCQWFVYQATKSYGKNKIM--TKLLDRMNFYVLPVFNVD 221

  Fly  1216 GYAYSHEYDRFWKKSRSQHQTPPPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGKRGSSK 1280
            ||.:|...||.|:|:||::|                     :..|.|.||:||:...|....::.
Mouse   222 GYIWSWTQDRMWRKNRSRNQ---------------------NSTCIGTDLNRNFDVSWDSSPNTN 265

  Fly  1281 APCNEFYAGPAPFSEPETKAVSEFLMDYRTQIKLYISLQAYGQVISYPVKANSTFN-SERLDDFL 1344
            .||...|.||||.||.|||||:.|:..:...||.||:..:|.|::..|.  ..||. .....|.|
Mouse   266 KPCLNVYRGPAPESEKETKAVTNFIRSHLNSIKAYITFHSYSQMLLIPY--GYTFKLPPNHQDLL 328

  Fly  1345 DVAMVGTDGLRKKGSKSRYKVDASNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGYLLPS 1409
            .||.:.||.|..: .::||........|.:.||.:..: .|::||..::..:|.|.|..|:|||.
Mouse   329 KVARIATDALSTR-YETRYIYGPIASTIYKTSGSSLDW-VYDLGIKHTFAFELRDKGKSGFLLPE 391

  Fly  1410 SAIEPTARDAFEIISGMLDYI 1430
            |.|:||.::....:..:..||
Mouse   392 SRIKPTCKETMLSVKFIAKYI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 21/80 (26%)
M14_CP_A-B_like 1089..1430 CDD:199844 101/341 (30%)
Cpa3NP_031779.1 Propep_M14 28..102 CDD:280416 22/82 (27%)
Peptidase_M14_like 114..413 CDD:299699 103/360 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.