DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and CG43235

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster


Alignment Length:93 Identity:26/93 - (27%)
Similarity:45/93 - (48%) Gaps:10/93 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   964 TSTTTTTSRPDVPRRISYDKYQIWR--LKPQDEEQVRALEEFKKGEDGVKLQWLKGPSLRGLTDV 1026
            |:..::.|.|..||  ||:.|.:::  :|.:.::||  ::...|..|...| |.:|   ..:..:
  Fly    12 TAWKSSLSDPIGPR--SYENYSVYKVFIKTRSDQQV--IDGLLKDTDNYNL-WHRG---LNVVHI 68

  Fly  1027 LVPPKMLVDFQGTLNYEGIAHEVLIFDV 1054
            :|.|.....|...:..|.|..||||.:|
  Fly    69 MVSPVEKDSFLAVMQKENIVVEVLIKNV 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 18/69 (26%)
M14_CP_A-B_like 1089..1430 CDD:199844
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 18/69 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.