DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and LOC100489361

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:XP_017952843.2 Gene:LOC100489361 / 100489361 -ID:- Length:454 Species:Xenopus tropicalis


Alignment Length:468 Identity:128/468 - (27%)
Similarity:216/468 - (46%) Gaps:85/468 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   978 RISYDKYQIWRLKPQDEEQVRALEEFKKGEDGVKLQWL-------------KGPSLRGLTDVLVP 1029
            ::.||..|:.::.||..:..:.::       |:..:|:             .|..:.    |.||
 Frog    22 KVKYDGDQVLKMIPQTLKHAQFMQ-------GLIQEWMLDLWKPVMVEQIQAGREMH----VRVP 75

  Fly  1030 PKMLVDFQGTLNYEGIAHEVLIFDVGKAIAYELTKEDYLQTTRPSKPRPTAPPPMTWNRYHNHDE 1094
            ...|.:.:..|....:.:::||.||     .||...:   |...:|.:..:.....:.:||..||
 Frog    76 FSHLQEIKEKLLQNMLPYQILISDV-----QELVNRN---TPIETKMQKISLDNYDYTKYHPMDE 132

  Fly  1095 IVKYLETVRMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKRKRKSGQAN 1159
            |..::|.::::|..||....:|.::|.||:...||            |..:.| ||:        
 Frog   133 IYDWMEQIQLKHRDLVTKHFMGSTYELRPIYYFKI------------GWPSDK-PKK-------- 176

  Fly  1160 AVFVEAGAQGLAWIGPAAATWMIAELLRLMKTNKSNEDVEFIRNTTWYIMPVLNPDGYAYSHEYD 1224
            .:|::.|.....||..|...|.:.|:|.....||...:|  ::...:|::||.|.|||.||...:
 Frog   177 IIFMDCGIHAREWIAVAYCQWFVKEILSSHSNNKLLTNV--LKQVDFYVVPVFNIDGYIYSWTTE 239

  Fly  1225 RFWKKSRSQHQTPPPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGKRGSSKAPCN-EFYA 1288
            |.|:|:||.|.                     :..||||||:||:...|...|:|: .|| :.:.
 Frog   240 RLWRKNRSPHN---------------------NATCYGVDLNRNFNSSWCSVGASR-DCNSQTFC 282

  Fly  1289 GPAPFSEPETKAVSEFLMDYRTQIKLYISLQAYGQVISYPVKANSTFNSERLDDFLDVAMVGTDG 1353
            |.||.|||||:||:..:...::||..|:::.:|||.|..|.  .||.|..  .:.:::..|....
 Frog   283 GSAPASEPETQAVANLMERTKSQILFYLTIHSYGQYILLPY--GSTTNPS--VNHVEMTKVAEAA 343

  Fly  1354 LRKKGSKSR--YKVDASNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGYLLPSSAIEPTA 1416
            ..|...|..  |.|.:|:.::.:.||.:..:|. :|||.||||.:|.|||.:|:.||:..|:||.
 Frog   344 AAKMKEKHNIVYTVGSSSVVLYENSGSSCDWAG-DIGIKFSYTFELRDNGTYGFQLPAELIKPTC 407

  Fly  1417 RDAFEIISGMLDY 1429
            .:....:..|::|
 Frog   408 EETMTAVISMMEY 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 14/82 (17%)
M14_CP_A-B_like 1089..1430 CDD:199844 107/344 (31%)
LOC100489361XP_017952843.2 Propep_M14 36..106 CDD:396700 15/85 (18%)
Peptidase_M14_like 124..420 CDD:416253 106/345 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.