DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and cpo

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001139101.1 Gene:cpo / 100005630 ZFINID:ZDB-GENE-070619-6 Length:363 Species:Danio rerio


Alignment Length:348 Identity:106/348 - (30%)
Similarity:179/348 - (51%) Gaps:50/348 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1086 WNRYHNHDEIVKYLETVRMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPK 1150
            :.:||..|||..::..::..:|.:|..:..|:::|.|.:.::||....|.             ||
Zfish    32 YTKYHTMDEISAWMNQMQRENPDVVSTMTYGQTYEKRNITLLKIGFSSTT-------------PK 83

  Fly  1151 RKRKSGQANAVFVEAGAQGLAWIGPAAATWMIAELLRLMKTNKSNEDVEFIRNTTWYIMPVLNPD 1215
            :        |::::.|.....||.||.....:.|:|...||: |..::.| :|..:||.||||.|
Zfish    84 K--------AIWMDCGIHAREWIAPAFCQHFVKEVLGSYKTD-SRVNMLF-KNLDFYITPVLNMD 138

  Fly  1216 GYAYS--HEYDRFWKKSRSQ-HQTPPPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGKRG 1277
            ||.||  :...|.|:||||. |:                     :..|.|.||:||:..:||..|
Zfish   139 GYIYSWLNNSTRLWRKSRSPCHE---------------------NSTCSGTDLNRNFYANWGMVG 182

  Fly  1278 SSKAPCNEFYAGPAPFSEPETKAVSEFLMDYRTQIKLYISLQAYGQVISYPVKANSTFNSERLDD 1342
            .|:..|:|.|.|....||||.:||::||..::..:..|:::.:|||:|..|. .:...::...|:
Zfish   183 ISRNCCSEVYNGATALSEPEAEAVTDFLGAHQNHLLCYLTIHSYGQLILVPY-GHPNISAPNYDE 246

  Fly  1343 FLDVAMVGTDGLRKKGSKSRYKVDASNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGYLL 1407
            .::|.:.....::....|| |||.:|.|::...||.:..||.. ||||:|:|.:|.|.|.||::|
Zfish   247 LMEVGLAAAKAIKAVHGKS-YKVGSSPDVLYPNSGSSRDFARL-IGIPYSFTFELRDEGQHGFIL 309

  Fly  1408 PSSAIEPTARDAFEIISGMLDYI 1430
            |...|:||.::|:|....:::|:
Zfish   310 PEDQIQPTCQEAYEGAMSIINYV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416
M14_CP_A-B_like 1089..1430 CDD:199844 105/343 (31%)
cpoNP_001139101.1 M14_CP_A-B_like 35..332 CDD:199844 105/343 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.