DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8945 and cpb2

DIOPT Version :9

Sequence 1:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001018539.2 Gene:cpb2 / 100000935 ZFINID:ZDB-GENE-050522-259 Length:424 Species:Danio rerio


Alignment Length:382 Identity:109/382 - (28%)
Similarity:179/382 - (46%) Gaps:60/382 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1040 LNYEGIAHEVLIFDVGKAIAYELTKEDYLQTTRPSKPRPTAPPPMTWNRYHNHDEIVKYLETVRM 1104
            |....|...||:.:....:|.::..:       .|.||...   :.:.|||:.::|..::.....
Zfish    85 LREHAITFRVLVEN
TAALVAMQIRND-------TSDPRSGG---VFYERYHSLEDIYYWINKTSR 139

  Fly  1105 RHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKRKRKSGQANAVFVEAGAQG 1169
            .|..:|::|.||.|.|.|||.|:|:..                    ||:.....|::::.|...
Zfish   140 EHSDMVKVILIGSSSEKRPLYVLKLSG--------------------KREEEVNRAMWMDCGIHA 184

  Fly  1170 LAWIGPAAATWMIAELLRLMKTNKSNEDVEFIRNTTWYIMPVLNPDGYAYSHEYDRFWKKSRSQH 1234
            ..||.||...|.:...|...  |::.|..|.:.....||:.|:|||||.|:...||.|:|:||::
Zfish   185 REWIAPAFCMWFVNYALAFY--NQNTEITEMLNKMDIYILTVMNPDGYKYTWTTDRMWRKNRSEN 247

  Fly  1235 QTPPPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGKRGSSKAPCNEFYAGPAPFSEPETK 1299
            :                     |..|.||||:||:..:|..:|:|..||:..|.|..|.|||||:
Zfish   248 K---------------------DSYCAGVDLNRNFDANWCTKGASDDPCDPTYCGQFPESEPETQ 291

  Fly  1300 AVSEFLMDYRTQIKLYISLQAYGQVISYPVKA--NSTFNSERLDDFLDVAMVGTDGLRKKGSKSR 1362
            ||::||..::..:|||:|:.:|.|::.:|...  |...|...|.:.:..|....    ::..::.
Zfish   292 AVAKFLRSHKDTVKLYLSIHSYSQMLLFPYSCSYNEIPNHNELFELVKEASTKI----RRYYRNN 352

  Fly  1363 YKVDASNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGYLLPSSAIEPTARDA 1419
            ||..:....|....|.:|.: ||::||.:|:|.:|.|.|.:|:|||.|.|.....:|
Zfish   353 YKYGSGAKTIYLAPGGSDDW-AYDLGIKYSFTFELQDRGQYGFLLPPSFIPQACNEA 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 4/17 (24%)
M14_CP_A-B_like 1089..1430 CDD:199844 100/333 (30%)
cpb2NP_001018539.2 Propep_M14 32..98 CDD:280416 4/12 (33%)
M14_CPB2 120..420 CDD:199868 101/337 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.