DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wcy and URN1

DIOPT Version :10

Sequence 1:NP_001259636.1 Gene:wcy / 32690 FlyBaseID:FBgn0030812 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_015478.1 Gene:URN1 / 856275 SGDID:S000006356 Length:465 Species:Saccharomyces cerevisiae


Alignment Length:95 Identity:30/95 - (31%)
Similarity:41/95 - (43%) Gaps:19/95 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 GDWSEHVSSSGKMYYYNCKTEISQWEKP--KEWVDRERNLPRDQHREKD--------------YR 332
            |:|.|..:.:||.||||..|:.|:||||  |:..:.|.|....|...|.              |.
Yeast     3 GEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLIIYN 67

  Fly   333 DKDRDRDRDDRFSRSTYKHSNSSRDNSRLR 362
            |..:....||   ...:|:..|..|:||.|
Yeast    68 DGTKLYFNDD---SKEFKNDISQEDDSRCR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wcyNP_001259636.1 PRP40 285..>405 CDD:227435 29/94 (31%)
WW 285..311 CDD:459800 12/25 (48%)
URN1NP_015478.1 PRP40 2..>88 CDD:227435 26/87 (30%)
WW 5..30 CDD:459800 12/24 (50%)
FF 219..263 CDD:426471
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.