DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and Smap1

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_001344324.1 Gene:Smap1 / 98366 MGIID:2138261 Length:467 Species:Mus musculus


Alignment Length:444 Identity:78/444 - (17%)
Similarity:133/444 - (29%) Gaps:161/444 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 LPDLRENDAKL-----QKEDYLRPDPDQEDDGCYEVPKTQGKPPSYDE---ALRSRPSPSDSPM- 411
            :.|:....|:|     ..|::.||..||..:  :.:.....|...||:   |: :..|.||:|: 
Mouse    86 MQDMGNTKARLLYEANLPENFRRPQTDQAVE--FFIRDKYEKKKYYDKNAIAI-TNISSSDAPLQ 147

  Fly   412 ---SRNLAQEAAQLVQLRNQRQLSSSSSNGDESPRLPMPAFPPPRLSQQPEQFRMDALQPPVRQK 473
               |....|.|....:|..:::........::.|..|.......:|.::.||    .|:|     
Mouse   148 PLVSSPSLQAAVDKNKLEKEKEKKKDEKKREKEPEKPAKPLTTEKLPKKEEQ----QLEP----- 203

  Fly   474 RRKNYEHIELRRPPVD--------SAQLEELNRAAAAAEREE----SLLIS-------AKNAEAE 519
             :|:........|.:|        .|.:...|.|.|.|..::    ..:||       ...|:..
Mouse   204 -KKSTSPKNAAEPTIDLLGLDGPAEAPVTNGNPATAPALSDDLDIFGPMISNPLPAAVMPPAQGT 267

  Fly   520 TKTPKPE-----RSDSWEFYGEDENEEEDRDEEQEGSSSPEPLYAN--QEATYGKLF-------- 569
            ...|.|.     .|...:.:.|...:.|:..::|....|...||..  |::|.|...        
Mouse   268 ASVPAPATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILSLYGTGAQQSTPGVFMGPTNIPFT 332

  Fly   570 -EMATAGSSRSNVLTPNQVAEQQQLACITEDSELDACEGAVGG---------------------- 611
             :..||.....::..|                 :.|..|.:|.                      
Mouse   333 SQAPTAFQGFPSMGVP-----------------VPAAPGLIGNMMGQNTGMMVGMPMHNGFMGNA 380

  Fly   612 ----VPLPQAVIEEFDPLSSKCSTLARSNKSNELLLLEHLLEEDTYGTVKAEQDDVSMCTSEEEP 672
                :||||.|:..                           :....|.:.|.|....:       
Mouse   381 QTGVMPLPQNVVGP---------------------------QGGMVGQMGAPQSKFGL------- 411

  Fly   673 TTSAATSPKPQQPQIVHQNARLLSDSMENMLDSDQERAKPYLSRMPESANKASG 726
                   |:.||||             .|:...:|:.|...||    |||.::|
Mouse   412 -------PQAQQPQ-------------WNLSQMNQQMAAMNLS----SANASAG 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
Smap1NP_001344324.1 ArfGap 20..120 CDD:307528 8/35 (23%)
Med15 <343..>451 CDD:312941 26/174 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.