DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and AGE2

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_012220.3 Gene:AGE2 / 854767 SGDID:S000001306 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:52/228 - (22%)
Similarity:85/228 - (37%) Gaps:35/228 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NNIKKLNINAENLHGNCAEKKL--PSSGQN-------------KLILQENNSDSQQPI-YGPDAN 88
            ||::..:.....|.....::|:  .||.||             .|...|..:||.:|: :.|.||
Yeast    82 NNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKWIGDLSSIEGLNDSTEPVLHKPSAN 146

  Fly    89 ENVQEPVYATPRPAPRQRLPPAGEPEDSYPDPDDEVPLRILRAAPQIPPKPLNILLDQRSSICSE 153
            .::         ||...||   .:..:|......:.|..:| :..:.....||:.:...|...|.
Yeast   147 HSL---------PASNARL---DQSSNSLQKTQTQPPSHLL-STSRSNTSLLNLQVSSLSKTTSN 198

  Fly   154 VSTTSVQTPGKADEDREGSR---YASNASLDCSESSHSGKFKSQSPGYVDAVDSSIPQ-SDHPDP 214
            .|.||..|...|...:.|:|   :.....|..|..|...|..:|:........|:.|| .:.|.|
Yeast   199 TSVTSSATSIGAANTKTGNRVGEFGQRNDLKKSILSLYSKPSAQTQSQNSFFTSTTPQPCNTPSP 263

  Fly   215 --NGHHPQAESSSAEQSSGSQDGDDDNNLLRSL 245
              |.......::|...:|.|....|||.|.:::
Yeast   264 FVNTGITATNNNSMNSNSSSNISLDDNELFKNV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
AGE2NP_012220.3 COG5347 1..298 CDD:227651 52/228 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.